Overview

  • Product name
  • Description
    Rabbit polyclonal to hCG alpha
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human hCG alpha aa 1-116.
    Sequence:

    MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPIL QCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKV ENHTACHCSTCYYHKS


    Database link: NP_000726.1

  • Positive control
    • hCG alpha-transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab171770 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 13 kDa.

Target

  • Sequence similarities
    Belongs to the glycoprotein hormones subunit alpha family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Anterior pituitary glycoprotein hormones common subunit alpha antibody
    • CG alpha antibody
    • CG-alpha antibody
    • cga antibody
    • Choriogonadotropin alpha chain antibody
    • Chorionic Gonadotrophin Alpha antibody
    • Chorionic Gonadotrophin Alpha Subunit antibody
    • Chorionic gonadotrophin subunit alpha antibody
    • chorionic gonadotropin, alpha polypeptide antibody
    • Follicle-stimulating hormone alpha antibody
    • Follicle-stimulating hormone alpha chain antibody
    • follicle-stimulating hormone alpha subunit antibody
    • Follitropin alpha antibody
    • Follitropin alpha chain antibody
    • FSH Alpha antibody
    • FSH-alpha antibody
    • FSHA antibody
    • GLHA_HUMAN antibody
    • Glycoprotein hormones alpha chain antibody
    • Glycoprotein Hormones Alpha Polypeptide antibody
    • GPH Alpha antibody
    • GPHa antibody
    • GPHA1 antibody
    • HCG antibody
    • hyrotropin alpha antibody
    • LH-alpha antibody
    • LHA antibody
    • LSH alpha antibody
    • LSH-alpha antibody
    • Luteinizing hormone alpha antibody
    • Luteinizing hormone alpha chain antibody
    • Lutropin alpha antibody
    • Lutropin alpha chain antibody
    • Thyroid Stimulating Hormone Alpha antibody
    • Thyroid Stimulating Hormone Alpha Chain antibody
    • Thyroid-stimulating hormone alpha chain antibody
    • Thyrotropin alpha chain antibody
    • TSH Alpha antibody
    • TSH-alpha antibody
    • TSHA antibody
    see all

Images

  • All lanes : Anti-hCG alpha antibody (ab171770) at 1 µg/ml

    Lane 1 : hCG alpha-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L), Peroxidase Conjugated at 1/7500 dilution

    Predicted band size: 13 kDa

References

ab171770 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171770.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up