Overview

  • Product name
  • Description
    Goat polyclonal to hCG
  • Host species
    Goat
  • Specificity
    Recognizes Human TSH (a), HCG (a), LH (a), and FSH (a) due to common glycoprotein hormones alpha chain.
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length native protein (purified) corresponding to Human hCG aa 1-116. purified from Human pituitary glands.
    Sequence:

    MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPIL QCMGCCFSRA YPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGF KVENHTACHCSTCYYHKS


    Database link: P01215

  • Positive control
    • Formalin-fixed, paraffin-embedded Human placenta tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab174715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.

Target

  • Relevance
    Human chorionic gonadotropin (hCG) is a glycoprotein hormone produced by trophoblastic cells of the placenta beginning 10 to 12 days after conception. Maintenance of the fetus in the first trimester of pregnancy requires the production of hCG, which binds to the corpus luteum of the ovary which is stimulated to produce progesterone which in turn maintains the secretory endometrium. hCG is present only in trace amounts in non pregnant urine and sera. It rises sharply during pregnancy. HCG is composed of two non identical, non covalently linked polypeptide chains designated as the a and b subunits. The a subunit of HCG is nearly identical to that of thyroid stimulating hormone (TSH), follicle stimulating hormone (FSH) and luteinizing hormone (LH). A germ cell tumor which is positive for cytokeratin, placental alkaline phosphatase (PLAP) and HCG but negative for EMA and AFP is probably a choriocarcinoma.
  • Cellular localization
    Secreted
  • Database links
  • Alternative names
    • anterior pituitary glycoprotein hormones common subunit alpha antibody
    • CG-ALPHA antibody
    • CGB antibody
    • CGB3 antibody
    • CGB5 antibody
    • CGB7 antibody
    • choriogonadotropin alpha chain antibody
    • Chorionic gonadotrophin chain beta antibody
    • chorionic gonadotrophin subunit alpha antibody
    • chorionic gonadotropin beta 3 subunit antibody
    • Chorionic gonadotropin beta chain antibody
    • Chorionic gonadotropin beta subunit antibody
    • chorionic gonadotropin, alpha polypeptide antibody
    • chorionic gonadotropin, beta polypeptide 3 antibody
    • chorionic gonadotropin, beta polypeptide antibody
    • follicle-stimulating hormone alpha chain antibody
    • follicle-stimulating hormone alpha subunit antibody
    • follitropin alpha chain antibody
    • FSH-alpha antibody
    • FSHA antibody
    • glycoprotein hormones alpha chain antibody
    • glycoprotein hormones, alpha polypeptide antibody
    • GPHa antibody
    • GPHA1 antibody
    • HCG antibody
    • hCGB antibody
    • Human Chorionic Gonadotropin antibody
    • LHA antibody
    • LSH-alpha antibody
    • luteinizing hormone alpha chain antibody
    • lutropin alpha chain antibody
    • thyroid-stimulating hormone alpha chain antibody
    • thyrotropin alpha chain antibody
    • TSH-alpha antibody
    • TSHA antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human placenta tissue labeling hCG with ab174715 at 5 µg/ml.

References

ab174715 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up