Overview

Description

  • NatureSynthetic
  • Amino Acid Sequence
    • SequenceA peptide taken from within the following sequence: QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII

Associated products

Specifications

Our Abpromise guarantee covers the use of ab124130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-HDAC9 antibody - ChIP Grade (ab59718)

  • FormLiquid

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C.

    Constituent: 100% PBS

General Info

  • Alternative names
    • HD 7
    • HD 7B
    • HD 9
    • HD7
    • HD7B
    • HD9
    • HDAC
    • HDAC 7
    • HDAC 7B
    • HDAC 9
    • HDAC 9B
    • HDAC 9FL
    • HDAC7
    • HDAC7B
    • HDAC9
    • HDAC9_HUMAN
    • HDAC9B
    • HDAC9FL
    • HDRP
    • Histone deacetylase 4/5 related protein
    • Histone deacetylase 7
    • Histone deacetylase 7B
    • Histone deacetylase 9
    • Histone deacetylase 9A
    • Histone deacetylase related protein
    • Histone deacetylase-related protein
    • KIAA0744
    • MEF2 interacting transcription repressor MITR
    • MEF2 interacting transcription repressor protein
    • MEF2-interacting transcription repressor MITR
    • MITR
    see all
  • FunctionResponsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Represses MEF2-dependent transcription.
    Isoform 3 lacks active site residues and therefore is catalytically inactive. Represses MEF2-dependent transcription by recruiting HDAC1 and/or HDAC3. Seems to inhibit skeletal myogenesis and to be involved in heart development. Protects neurons from apoptosis, both by inhibiting JUN phosphorylation by MAPK10 and by repressing JUN transcription via HDAC1 recruitment to JUN promoter.
  • Tissue specificityBroadly expressed, with highest levels in brain, heart, muscle and testis. Isoform 3 is present in human bladder carcinoma cells (at protein level).
  • Involvement in diseaseNote=A chromosomal aberration involving HDAC9 is found in a family with Peters anomaly. Translocation t(1;7)(q41;p21) with TGFB2 resulting in lack of HDAC9 protein.
  • Sequence similaritiesBelongs to the histone deacetylase family. HD type 2 subfamily.
  • Post-translational
    modifications
    Phosphorylated on Ser-220 and Ser-450; which promotes 14-3-3-binding, impairs interaction with MEF2, and antagonizes antimyogenic activity. Phosphorylated on Ser-240; which impairs nuclear accumulation (By similarity). Isoform 7 is phosphorylated on Tyr-1010. Phosphorylated by the PKC kinases PKN1 and PKN2, impairing nuclear import.
    Sumoylated.
  • Cellular localizationNucleus.
  • Information by UniProt

References for HDAC9 peptide (ab124130)

ab124130 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your patience. We added the peptide to our catalog as ab124130. http://www.abcam.com/HDAC9-peptide-ab124130.html The price is $160.00 for 100 ug. The product is currently not in stock. If you would place the...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"