Anti-HDHD3 antibody - C-terminal (ab178033)

Overview

  • Product name
    Anti-HDHD3 antibody - C-terminal
    See all HDHD3 primary antibodies
  • Description
    Rabbit polyclonal to HDHD3 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse
  • Immunogen

    Synthetic peptide within Human HDHD3 aa 188-237 (C terminal). The exact sequence is proprietary. NP_112496.1
    Sequence:

    AHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHL


    Database link: Q9BSH5

  • Positive control
    • MCF7 whole cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab178033 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa.

Target

Images

  • Anti-HDHD3 antibody - C-terminal (ab178033) at 1 µg/ml + MCF7 whole cell lysate at 10 µg

    Predicted band size: 28 kDa

References

ab178033 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178033.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up