Overview

  • Product name
  • Description
    Rabbit polyclonal to HEATR5B
  • Tested applications
    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence: VPPPVSAALQGIKSIVTLSMAKTEAGVQKQWTALIRSTLACILEYSQPED SVPTPDEVSMLTAIALFLWSASNEIIGVQSLQNGCMNRF, corresponding to amino acids of Human HEATR5B.

  • Positive control
    • Human duodenum tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab126296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

Target

Images

  • Immunofluorescent staining of Human cell line A-431 shows positivity in nucleus, nucleoli and cytoplasm. Recommended concentration of ab126296 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab126296 at 1/200 dilution, staining HEATR5B in paraffin-embedded Human duodenum tissue by Immunohistochemistry.

References

ab126296 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab126296.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up