Overview

  • Product name
  • Description
    Rabbit polyclonal to HEBP1
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human HEBP1 aa 69-126 (internal sequence).
    Sequence:

    TNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDK SVKIEERE


    Database link: Q9NRV9

  • Positive control
    • Human duodenum tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab185568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    May bind free porphyrinogens that may be present in the cell and thus facilitate removal of these potentially toxic compound. Binds with a high affinity to one molecule of heme or porphyrins. It binds metalloporphyrins, free porphyrins and N-methylprotoporphyrin with similar affinities.
  • Sequence similarities
    Belongs to the HEBP family.
  • Domain
    Forms a distorted beta-barrel structure, with two helices that are packed against the outer surface of the barrel. Porphyrins are expected to bind to a hydrophobic patch on the outer surface of the beta-barrel structure.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • HBP antibody
    • HEBP antibody
    • Hebp1 antibody
    • HEBP1_HUMAN antibody
    • Heme binding protein 1 antibody
    • Heme-binding protein 1 antibody
    • p22HBP antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human duodenum tissue labeling HEBP1 with ab185568 at 1/50 dilution.

References

ab185568 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up