Anti-Heparin Cofactor II antibody (ab97846)

Overview

  • Product nameAnti-Heparin Cofactor II antibody
    See all Heparin Cofactor II primary antibodies
  • Description
    Rabbit polyclonal to Heparin Cofactor II
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 323 - 372 (

    VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ

    ) of Human Heparin Cofactor II (NP_000176).

  • Positive control
    • THP1 cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab97846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionThrombin inhibitor activated by the glycosaminoglycans, heparin or dermatan sulfate. In the presence of the latter, HC-II becomes the predominant thrombin inhibitor in place of antithrombin III (AT-III). Also inhibits chymotrypsin, but in a glycosaminoglycan-independent manner.
    Peptides at the N-terminal of HC-II have chemotactic activity for both monocytes and neutrophils.
  • Tissue specificityExpressed predominantly in liver. Also present in plasma.
  • Involvement in diseaseThrombophilia due to heparin cofactor 2 deficiency
  • Sequence similaritiesBelongs to the serpin family.
  • DomainThe N-terminal acidic repeat region mediates, in part, the glycosaminoglycan-accelerated thrombin inhibition.
  • Post-translational
    modifications
    Phosphorylation sites are present in the extracellular medium.
  • Information by UniProt
  • Database links
  • Alternative names
    • D22S673 antibody
    • HC II antibody
    • HC-II antibody
    • HC2 antibody
    • HCF2 antibody
    • HEP2_HUMAN antibody
    • Heparin cofactor 2 antibody
    • Heparin cofactor II antibody
    • HLS2 antibody
    • Leuserpin 2 antibody
    • LS2 antibody
    • Protease inhibitor leuserpin 2 antibody
    • Protease inhibitor leuserpin-2 antibody
    • serine (or cysteine) proteinase inhibitor, clade D (heparin cofactor), member 1 antibody
    • Serpin D1 antibody
    • serpin peptidase inhibitor, clade D (heparin cofactor), member 1 antibody
    • SERPIND1 antibody
    • THPH10 antibody
    see all

Anti-Heparin Cofactor II antibody images

  • Anti-Heparin Cofactor II antibody (ab97846) at 1 µg/ml (in 5% skim milk / PBS buffer) + THP1 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 55 kDa

References for Anti-Heparin Cofactor II antibody (ab97846)

ab97846 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab97846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"