Anti-Hepatitis C Virus Core Antigen antibody [H6-29] (Biotin) (ab192050)

Overview

  • Product name
    Anti-Hepatitis C Virus Core Antigen antibody [H6-29] (Biotin)
    See all Hepatitis C Virus Core Antigen primary antibodies
  • Description
    Mouse Monoclonal [H6-29] to Hepatitis C Virus Core Antigen (Biotin)
  • Host species
    Mouse
  • Conjugation
    Biotin
  • Tested applications
    Suitable for: ICC/IF, WB, IHC-Frmore details
  • Species reactivity
    Reacts with: Hepatitis C virus
  • Immunogen

    Recombinant fragment within Hepatitis C Virus Hepatitis C Virus Core Antigen aa 13-124 (internal sequence). The exact sequence is proprietary. corresponding to part of the Core protein region. Expressed in E. coli.
    Sequence:

    RNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRAPRKTSERSQPRGRR QPIPKARRPE GRTWAQPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPT DPRRRSRNLGKVID


    Database link: P26663

  • Positive control
    • Chimpanzee liver infected with recombinant vaccinia virus containing a Hepatitis C virus genome cDNA lysate and cells. Human liver tissue from a patient with chronic hepatitis C.
  • General notes

    Biotin conjugated [biotin] / [IgG] = 6.6.

Properties

Applications

Our Abpromise guarantee covers the use of ab192050 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Detects a band of approximately 22 kDa (predicted molecular weight: 22 kDa).
IHC-Fr Use at an assay dependent concentration.

Target

  • Relevance
    The hepatitis C virus (HCV) core protein represents the first 191 amino acids of the viral precursor polyprotein and is cotranslationally inserted into the membrane of the endoplasmic reticulum. Hepatitis C virus (HCV) core is a viral structural protein; it also participates in some cellular processes, including transcriptional regulation. However the mechanisms of core-mediated transcriptional regulation remain poorly understood. Hepatitis C virus (HCV) core protein is thought to contribute to HCV pathogenesis through its interaction with various signal transduction pathways. In addition, HCV core antigen is a recently developed marker of hepatitis C infection. The HCV core protein has been previously shown to circulate in the bloodstream of HCV-infected patients and inhibit host immunity through an interaction with gC1qR. Hepatitis C Virus is a positive, single stranded RNA virus in the Flaviviridae family. The genome is approximately 10,000 nucleotides and encodes a single polyprotein of about 3,000 amino acids. The polyprotein is processed by host cell and viral proteases into three major structural proteins and several non structural proteins necessary for viral replication. Hepatitis C virus (HCV) causes most cases of non-A, non-B hepatitis and results in most HCV infected people developing chronic infections, liver cirrhosis and hepatocellular carcinoma. T cell responses, including interferon-gamma production are severely suppressed in chronic HCV patients.
  • Cellular localization
    Endoplasmic reticulum
  • Database links
    • Alternative names
      • Core protein p21 antibody
      • HCV core antigen antibody
      • HCV core protein antibody
      • Hepatitis C Virus core protein antibody

    Images

    • Anti-Hepatitis C Virus Core Antigen antibody [H6-29] (Biotin) (ab192050) + chimpanzee liver infected with recombinant vaccinia virus containing a Hepatitis C virus genome cDNA cell lysate

      Predicted band size: 22 kDa
      Observed band size: 22 kDa

    • Immunofluorescence analysis of acetone-fixed cells from chimpanzee liver infected with recombinant vaccinia virus containing a Hepatitis C virus genome cDNA cells, labeling Hepatitis C Virus NS4A using ab192050.

    • Immunohistochemical analysis of Human liver tissue from a patient with chronic hepatitis C, labeling Hepatitis C Virus NS4A using ab192050. Counterstained with hematoxylin.

    References

    ab192050 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab192050.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up