Overview

  • Product nameAnti-HERC4 antibody
    See all HERC4 primary antibodies
  • Description
    Rabbit polyclonal to HERC4
  • Specificityab113827 should bind to isoforms 1, 2, 3, 4 and 5 of Human HERC4, but not isoform 6.
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 39-88 (

    VGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEILKVCQISRLYR

    ) of Human HERC4 (NP_001017972).

  • Positive control
    • Human fetal liver lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab113827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 13 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionProbable E3 ubiquitin-protein ligase involved in either protein trafficking or in the distribution of cellular structures. Required for spermatozoon maturation and fertility, and for the removal of the cytoplasmic droplet of the spermatozoon. E3 ubiquitin-protein ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer it to targeted substrates.
  • Tissue specificityExpressed in brain and testis and detected in heart and placenta.
  • PathwayProtein modification; protein ubiquitination.
  • Sequence similaritiesContains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain.
    Contains 7 RCC1 repeats.
  • Developmental stageExpressed in fetal brain.
  • Cellular localizationCytoplasm > cytosol. shows a punctate cytoplasmic distribution.
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZP564G092 antibody
    • HECT and RLD domain containing E3 ubiquitin protein ligase 4 antibody
    • HECT domain and RCC1 like domain containing protein 4 antibody
    • HECT domain and RCC1-like domain-containing protein 4 antibody
    • Hect domain and RLD 4 antibody
    • HERC 4 antibody
    • HERC4 antibody
    • HERC4_HUMAN antibody
    • KIAA1593 antibody
    • Probable E3 ubiquitin protein ligase HERC4 antibody
    • Probable E3 ubiquitin-protein ligase HERC4 antibody
    see all

Anti-HERC4 antibody images



  • Predicted band size : 13 kDa
    Observed band size : 13 kDa

References for Anti-HERC4 antibody (ab113827)

ab113827 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113827.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"