Anti-Herstatin antibody [10C7] (ab39621)

Overview

  • Product name
    Anti-Herstatin antibody [10C7]
  • Description
    Mouse monoclonal [10C7] to Herstatin
  • Specificity
    ab39621 recognises recombinant human herstatin and human serum herstatin. The amino acid sequence of the recombinant human herstatin is 100% homologous with the amino acid sequence of the human serum herstatin.
  • Tested applications
    Suitable for: ELISA, WB, IHC-Frmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Herstatin aa 23-419.
    Sequence:

    THSLPPRPAAVPVPLRMQPGPAHPVLSFLRPSWDLVSAFYSLPLAPLSPT SVPISPVSVGRGPDPDAHVAVDLSRYEG


    Database link: Q9UK79

  • General notes

    Abcam is committed to meeting high standards of ethical manufacturing and as such, we will be discontinuing this product, which has been generated by the ascites method, within the next year. We are sorry for any inconvenience this may cause. If you would like help finding an alternative product, please do not hesitate to contact our scientific support team.

Properties

Applications

Our Abpromise guarantee covers the use of ab39621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.
WB Use at an assay dependent concentration.
IHC-Fr 1/800.

References

ab39621 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for your inquiry.

Most of our many monoclonal antibody for Her2 (ErbB-2, CD340) contain preservatives and other additives like BSA etc.

We do offer clean up-kits if you re interested?

We offer one antibody with t...

Read More

Thank you for contacting us. I have included information about the ErbB1 peptides and antibodies below. In addition I have attached our ELISA protocols and further information about direct labeling of our antibodies as requested.

http://www....

Read More

For far -red detection, we recommend a tandem dye conjugation kit, PE-Cy7. The catalogue ID is ab102902:

Click here (or use the following: http://www.abcam.com/index.html?datasheet=102902).

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up