Overview

  • Product name
  • Description
    Mouse polyclonal to HES6
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Full length protein corresponding to Human HES6 aa 1-224.
    Sequence:

    MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRL LLAGAEVQAKLENAEVLELTVRRVQGVLRGRAREREQLQAEASERFAAGY IQCMHEVHTFVSTCQAIDATVAAELLNHLLESMPLREGSSFQDLLGDALA GPPRAPGRSGWPAGGAPGSPIPSPPGPGDDLCSDLEEAPEAELSQAPAEG PDLVPAALGSLTTAQIARSVWRPW


    Database link: NP_061115.2

  • Positive control
    • HES6 transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172800 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa.

Target

  • Relevance
    HES6 is a transcription cofactor that iteself does not bind to DNA but suppresses both HES1-mediated N box-dependent transcriptional repression and binding of HES1 to E box sequences. It also suppresses HES1-mediated inhibition of the heterodimer formed by ASCL1/MASH1 and TCFEA2/E47, allowing ASCL1 and TCFEA2 to upregulate transcription in its presence. HES6 appears to have novel functions in tumour and cancer cell lines, although these have not yet been elucidated fully.
  • Cellular localization
    Nuclear
  • Database links
  • Alternative names
    • bHLHb41 antibody
    • bHLHc23 antibody
    • C HAIRY1 antibody
    • Class B basic helix-loop-helix protein 41 antibody
    • Hairy and enhancer of split 6 antibody
    • Hairy/enhancer of split 6, Drosophila, homolog of, 6 antibody
    • HES 6 antibody
    • hes family bHLH transcription factor 6 antibody
    • Transcription cofactor HES6 antibody
    see all

Images

  • All lanes : Anti-HES6 antibody (ab172800) at 1 µg/ml

    Lane 1 : HES6 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 24 kDa

References

ab172800 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Tissue lysate - whole (Mouse Liver)
Gel Running Conditions
Reduced Denaturing (12)
Loading amount
35 µg
Specification
Mouse Liver
Blocking step
Odyssey Blocking Buffer (TBS) 1:1 in TBS as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 50% · Temperature: RT°C
Username

Thomas Gantert

Verified customer

Submitted Aug 31 2016

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up