Overview

  • Product name
    Anti-HFH4 antibody [CL3989]
    See all HFH4 primary antibodies
  • Description
    Mouse monoclonal [CL3989] to HFH4
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human HFH4 aa 183-307.
    Sequence:

    PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEP SAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRV AKVPRPPSTLLPTPEEQGELEPLKG


    Database link: Q92949

  • Epitope
    Binds to an epitope located within the peptide sequence EPGKGGFWRI (aa 188-197) as determined by overlapping synthetic peptides.
  • Positive control
    • Human fallopian tube and endometrium tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab220028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    May play an important role in cell fate determination during lung development and in spermatogenesis.
  • Tissue specificity
    Testis, oviduct, lung and brain cortex.
  • Involvement in disease
    Genetic variations in FOXJ1 may be associated with susceptibility to allergic rhinitis (ALRH) [MIM:607154]. Allergic rhinitis is a common disease of complex inheritance and is characterized by mucosal inflammation caused by allergen exposure.
  • Sequence similarities
    Contains 1 fork-head DNA-binding domain.
  • Developmental stage
    Expressed in developing lung, kidney and central nervous system.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • FKHL13 antibody
    • Forkhead box J1 antibody
    • Forkhead box protein J1 antibody
    • Forkhead Homologue 4 antibody
    • Forkhead related protein FKHL13 antibody
    • Forkhead-related protein FKHL13 antibody
    • Fox J1 antibody
    • Foxj1 antibody
    • FOXJ1_HUMAN antibody
    • Hepatocyte nuclear factor 3 forkhead homolog 4 antibody
    • HFH 4 antibody
    • HFH-4 antibody
    • HFH4 antibody
    • HNF 3/forkhead homolog 4 antibody
    • MGC35202 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human fallopian tube tissue labeling HFH4 with ab220028 at 1/1000 dilution.

  • Immunohistochemical analysis of paraffin-embedded human endometrium tissue labeling HFH4 with ab220028 at 1/1000 dilution.

References

ab220028 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up