Anti-Histone H2A-Bbd antibody - N-terminal (ab175140)

Overview

  • Product name
    Anti-Histone H2A-Bbd antibody - N-terminal
    See all Histone H2A-Bbd primary antibodies
  • Description
    Rabbit polyclonal to Histone H2A-Bbd - N-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human Histone H2A-Bbd aa 10-59 (N terminal). The exact sequence is proprietary. Also SwissProt ID: P0C5Y9
    Sequence:

    SSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAV


    Database link: P0C5Z0

  • Positive control
    • A549 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab175140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 15 kDa.

Target

  • Function
    Atypical histone H2A which can replace conventional H2A in some nucleosomes and is associated with active transcription and mRNA processing. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. Nucleosomes containing this histone are less rigid and organize less DNA than canonical nucleosomes in vivo. They are enriched in actively transcribed genes and associate with the elongating form of RNA polymerase. They associate with spliceosome components and are required for mRNA splicing. May participate in spermatogenesis.
  • Tissue specificity
    Present in mature sperm.
  • Sequence similarities
    Belongs to the histone H2A family.
  • Domain
    The docking domain is responsible for the weaker heterodimerization with H2B.
  • Cellular localization
    Nucleus. Chromosome. Associated with the active X chromosome and with autosomes, while it is absent from the inactive X chromosome and excluded from Barr bodies.
  • Information by UniProt
  • Database links
  • Alternative names
    • H2A Barr body deficient antibody
    • H2A Barr body-deficient antibody
    • H2A histone family member B antibody
    • H2A.Bbd antibody
    • H2AB2_HUMAN antibody
    • H2ABBD antibody
    • H2AFB antibody
    • H2AFB1 antibody
    • H2AFB2 antibody
    • H2AFB3 antibody
    • Histone H2A BBD antibody
    • Histone H2A-Bbd type 1 antibody
    • Histone H2A-Bbd type 2/3 antibody
    see all

Images

  • Anti-Histone H2A-Bbd antibody - N-terminal (ab175140) at 1 µg/ml + A549 cell lysate at 10 µg

    Predicted band size : 15 kDa

References

ab175140 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175140.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up