Overview

  • Product name
    Anti-HLA-C antibody (Biotin)
    See all HLA-C primary antibodies
  • Description
    Rabbit polyclonal to HLA-C (Biotin)
  • Conjugation
    Biotin
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HLA-C aa 25-308. Extracellular domain.
    Sequence:

    CSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAP WVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSG CDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAA RAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEAT LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP SGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPI


    Database link: P10321

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Protein G purified
  • Purification notes
    >95%,Protein G purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193383 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Information by UniProt
  • Database links
  • Alternative names
    • 1C07_HUMAN antibody
    • Cw-7 alpha chain antibody
    • D6S204 antibody
    • HLA class I histocompatibility antigen antibody
    • HLA class I histocompatibility antigen, C alpha chain antibody
    • HLA class I histocompatibility antigen, Cw-1 alpha chain antibody
    • HLA-C antibody
    • HLA-C histocompatibility type antibody
    • HLA-Cw antibody
    • HLA-JY3 antibody
    • HLAC antibody
    • HLC-C antibody
    • human leukocyte antigen-C alpha chain antibody
    • major histocompatibility antigen HLA-C antibody
    • major histocompatibility complex, class I, C antibody
    • MHC class I antigen antibody
    • MHC class I antigen Cw 1 antibody
    • MHC class I antigen Cw*7 antibody
    • MHC class I antigen heavy chain HLA-C antibody
    • PSORS1 antibody
    see all

Images

  • Ab19383 staining HLA-C in paraffin embedded human lymph node tissue sections by Immunohistochemistry (IHC-P-paraformaldehyde-fixed, paraffin-embedded sections) at a 1:100 dilution.

References

ab193383 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193383.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up