Overview

  • Product name
  • Description
    Rabbit polyclonal to HLA-DP
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Pig
  • Immunogen

    Synthetic peptide corresponding to Human HLA-DP aa 211-260 (internal sequence).
    Sequence:

    AQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL

  • Positive control
    • Fetal thymus lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab89712 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    HLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a vital role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (B lymphocytes, dendritic cells and macrophages). Within the DP molecule the alpha and beta chain contain the polymorphisms governing the peptide binding specificities, resulting in up to 4 different molecules.
  • Cellular localization
    Type I membrane protein; Cell Membrane, Endoplasmic reticulum and Golgi Apparatus
  • Database links
  • Alternative names
    • DP(W3) antibody
    • DP(W4) antibody
    • HLA class II histocompatibility antigen DP alpha 1 chain antibody
    • HLA class II histocompatibility antigen DP alpha chain antibody
    • HLA DP1A antibody
    • HLA DPA 1 antibody
    • HLA SB alpha chain antibody
    • HLADP antibody
    • HLADPA1 antibody
    • HLASB antibody
    • HLASB histocompatibility type antibody
    • Human MHC class II HLA SB alpha gene antibody
    • Major histocompatibility complex class II DP alpha 1 antibody
    • MHC class II antigen antibody
    • MHC class II DP3 alpha antibody
    • MHC class II DPA1 antibody
    • MHC class II HLA DPA1 antigen antibody
    • PLT1 antibody
    • Primed lymphocyte test 1 antibody
    see all

Anti-HLA-DP antibody images

  • Anti-HLA-DP antibody (ab89712) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal thymus lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 29 kDa
    Gel concentration: 12%

References for Anti-HLA-DP antibody (ab89712)

ab89712 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab89712.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up