Overview

  • Product name
    Anti-hlgB antibody
  • Description
    Rabbit polyclonal to hlgB
  • Specificity
    Due to the high level of homology among the bi-component cytolysins, ab190338 demonstrates cross-reactivity to rHlg C, rLukF-PV and rLukS-PV . The immunogen contained a His-tag, therefore, proteins containing a His-epitope tag may also cross-react. This antibody is an IgG fraction of serum and therefore may have antibodies to other antigens including Staphylococcal antigens as a result of natural exposure and immune response.
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Staphylococcus aureus
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to hlgB aa 1-325. Immunogen species: Staphylococcus aureus
    Sequence:

    MKMNKLVKSSVATSMALLLLSGTANAEGKITPVSVKKVDDKVTLYKTTAT ADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFS KLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISI SNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNN GWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPE FLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTF KSTYEIDWENHKVKLLDTKETENNK


    Database link: P0A075

  • Positive control
    • Recombinant hlg B protein, culture supernatants of Staphylococcus aureus strains USA300 , Newman and NCTC 8325-4.
  • General notes

    av190338 can be used for detection of gamma-hemolysin secreted by S. aureus.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.01% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190338 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 µg/ml. Predicted molecular weight: 37 kDa.
ELISA Use at an assay dependent concentration.

Target

  • Relevance
    Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity.
  • Database links
    • Alternative names
      • Gamma hemolysin component B antibody
      • H gamma 1 antibody
      • H gamma I antibody

    Images

    • All lanes : Anti-hlgB antibody (ab190338) at 0.5 µg/ml

      Lane 1 : Culture supernatant of Staphylococcus aureus strain USA300
      Lane 2 : Culture supernatant of Staphylococcus aureus strain Newman
      Lane 3 : Culture supernatant of Staphylococcus aureus strain NCTC 8325-4
      Lane 4 : Culture supernatant of Staphylococcus aureus strain exoprotein negative NCTC 8325-4

      Lysates/proteins at 15 µl per lane.

      Secondary
      Anti-rabbit IgG-AP conjugate

      Predicted band size : 37 kDa
      Observed band size : <40 kDa (why is the actual band size different from the predicted?)
    • Anti-hlgB antibody (ab190338) at 0.5 µg/ml + Recombinant hlg B protein at 0.1 µg

      Secondary
      Anti-rabbit IgG-AP conjugate

      Predicted band size : 37 kDa

    References

    ab190338 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab190338.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up