Overview

  • Product nameAnti-HMGCLL1 antibody
    See all HMGCLL1 primary antibodies
  • Description
    Rabbit polyclonal to HMGCLL1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 2-51 (

    GNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKIV

    ) of Human HMGCLL1 (NP_001035865).

  • Positive control
    • OVCAR-3 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab94787 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 36 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceHMGCLL1 is involved in the catabolism of branched amino acids such as leucine.
  • Database links
  • Alternative names
    • 3 hydroxymethyl 3 methylglutaryl CoA lyase like 1 antibody
    • 3 hydroxymethyl 3 methylglutaryl CoA lyase like protein 1 antibody
    • 3 hydroxymethyl 3 methylglutaryl CoA lyase, cytoplasmic antibody
    • 3 hydroxymethyl 3 methylglutaryl Coenzyme A lyase like 1 antibody
    • bA418P12.1 antibody
    • Endoplasmic reticulum 3 hydroxymethyl 3 methylglutaryl CoA lyase antibody
    • er cHL antibody
    • Probable 3 hydroxymethyl 3 methylglutaryl CoA lyase 2 antibody
    see all

Anti-HMGCLL1 antibody images

References for Anti-HMGCLL1 antibody (ab94787)

ab94787 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94787.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"