Anti-HMW Cytokeratin antibody [KRTH/1076] (ab215849)

Overview

  • Product name
    Anti-HMW Cytokeratin antibody [KRTH/1076]
    See all HMW Cytokeratin primary antibodies
  • Description
    Mouse monoclonal [KRTH/1076] to HMW Cytokeratin
  • Specificity
    ab215849 recognizes HMW (Type II or basic) cytokeratins, which include 67kDa (CK1); 64kDa (CK3); 59kDa (CK4); 58kDa (CK5); 56kDa (CK6); 52kDa (CK8).
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Cytokeratin 2 aa 1-638.
    Sequence:

    MNRQVCKKSFSGRSQGFSGRSAVVSGSSRMSCVARSGGAGGGACGFRSGA GSFGSRSLYNLGSNKSISISVAAGSSRAGGFGGGRSSCGFAGGYGGGFGG SYGGGFGGGRGVGSGFGGAGGFGGAGGFGGPGVFGGPGSFGGPGGFGPGG FPGGIQEVIVNQSLLQPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDK VRFLEQQNKVLETKWELLQQQTTGSGPSSLEPCFESYISFLCKQLDSLLG ERGNLEGELKSMQDLVEDFKKKYEDEINKRTAAENEFVGLKKDVDAAFMN KVELQAKVDSLTDEVSFLRTLYEMELSQMQSHASDTSVVLSMDNNRCLDL GSIIAEVRAQYEEIAQRSKSEAEALYQTKLGELQTTAGRHGDDLRNTKSE IMELNRMIQRLRAEIENVKKQNANLQTAIAEAEQRGEMALKDANAKLQDL QTALQKAKDDLARLLRDYQELMNVKLALDVEIATYRKLLEGEECRMSGEC QSAVCISVVSNVTSTSGSSGSSRGVFGGVSGSGSGGYKGGSSSSSSSGYG VSGGSGSGYGGVSSGSTGGRGSSGSYQSSSSGSRLGGAGSISVSHSGMGS SSGSIQTSGGSGYKSGGGGSTSIRFSQTTSSSQHSSTK


    Database link: Q01546

  • Positive control
    • Human skin tissue; Rat stomach and oviduct tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab215849 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.25 - 0.5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

(Primary incubation for 30 minutes at RT).

Target

  • Relevance
    Cytokeratins are intermediate filament keratins found in the intracytoplasmic cytoskeleton of epithelial tissue. There are two types of Cytokeratins: the low weight, acidic type I cytokeratins and the high weight, basic or neutral type II. Cytokeratins are usually found in pairs comprising a type I Cytokeratin and a type II cytokeratin. The high molecular weight cytokeratins, which are the basic or neutral cytokeratins, comprise subtypes CK1 (67), CK2 (65.5), CK3 (64), CK4 (59), CK5 (58), CK6 (56), CK7 (54), CK8 (52.5) and CK9. The low molecular weight cytokeratins, which are the acidic cytokeratins, comprise subtypes CK10 (56.5), CK12 (56), CK13 (53), CK14 (50), CK16( 48), CK17 (46), CK18 (45), CK19(48) and CK20(46).
  • Cellular localization
    Cytoplasmic
  • Database links
  • Alternative names
    • CK13 antibody
    • CK14 antibody
    • CK15 antibody
    • CK16 antibody
    • Cytokeratin 13 antibody
    • Cytokeratin 14 antibody
    • Cytokeratin 15 antibody
    • Cytokeratin 16 antibody
    • K13 antibody
    • K14 antibody
    • K15 antibody
    • K16 antibody
    • Keratin 13 antibody
    • Keratin 14 antibody
    • Keratin 15 antibody
    • Keratin 15, basic antibody
    • Keratin 15, beta antibody
    • Keratin 16 antibody
    • KRT13 antibody
    • KRT14 antibody
    • KRT15 antibody
    • KRT16 antibody
    • KRT16A antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human skin tissue labeling HMW Cytokeratin with ab215849 at 0.5 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat stomach tissue labeling HMW Cytokeratin with ab215849 at 0.5 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat oviduct tissue labeling HMW Cytokeratin with ab215849 at 0.5 µg/ml.

References

ab215849 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215849.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up