Anti-HNF-4-alpha antibody [K9218] - ChIP Grade (ab41898)

Overview

  • Product nameAnti-HNF-4-alpha antibody [K9218] - ChIP GradeSee all HNF-4-alpha primary antibodies ...
  • Description
    Mouse monoclonal [K9218] to HNF-4-alpha - ChIP Grade
  • SpecificityRecognizes human HNF4 alpha 1-6.
  • Tested applicationsWB, ELISA, IP, IHC-P, ICC/IF, Flow Cyt, ChIP, Gel supershift assaysmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Cow, Human
    Predicted to work with: Pig
  • Immunogen

    Recombinant fragment corresponding to Human HNF-4-alpha aa 3-49.
    Sequence:

    MADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSAL

  • Positive control
    • Human liver hepatocytes and rat intestine epithelial cell.

Properties

Applications

Our Abpromise guarantee covers the use of ab41898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 53 kDa (predicted molecular weight: 53 kDa).
ELISA Use a concentration of 0.1 µg/ml.
IP Use at an assay dependent dilution.
IHC-P Use a concentration of 10 - 20 µg/ml.
ICC/IF Use a concentration of 1 µg/ml.
Flow Cyt Use 1-2µg for 106 cells.
ChIP Use at an assay dependent dilution. PubMed: 20463007
Gel supershift assays Use at an assay dependent dilution.

Target

  • FunctionTranscriptionally controlled transcription factor. Binds to DNA sites required for the transcription of alpha 1-antitrypsin, apolipoprotein CIII, transthyretin genes and HNF1-alpha. May be essential for development of the liver, kidney and intestine.
  • Involvement in diseaseDefects in HNF4A are the cause of maturity-onset diabetes of the young type 1 (MODY1) [MIM:125850]; also symbolized MODY-1. MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease.
  • Sequence similaritiesBelongs to the nuclear hormone receptor family. NR2 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residue(s); phosphorylation is important for its DNA-binding activity. Phosphorylation may directly or indirectly play a regulatory role in the subnuclear distribution.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ39654 antibody
    • Hepatic nuclear factor 4 alpha antibody
    • Hepatocyte nuclear factor 4 alpha antibody
    • Hepatocyte nuclear factor 4 antibody
    • Hepatocyte nuclear factor 4-alpha antibody
    • HNF 4 alpha antibody
    • HNF 4 antibody
    • HNF-4-alpha antibody
    • HNF4 antibody
    • HNF4 antibody
    • HNF4A antibody
    • HNF4A_HUMAN antibody
    • HNF4a7 antibody
    • HNF4a8 antibody
    • HNF4a9 antibody
    • Hnf4alpha antibody
    • MODY 1 antibody
    • MODY antibody
    • MODY1 antibody
    • NR2A1 antibody
    • NR2A1 antibody
    • NR2A21 antibody
    • Nuclear receptor subfamily 2 group A member 1 antibody
    • OTTHUMP00000031060 antibody
    • OTTHUMP00000031062 antibody
    • TCF 14 antibody
    • TCF antibody
    • TCF-14 antibody
    • TCF14 antibody
    • TCF14 antibody
    • Tcf4 antibody
    • Transcription factor 14, hepatic nuclear factor antibody
    • Transcription factor 14 antibody
    • Transcription factor HNF 4 antibody
    • Transcription factor HNF-4 antibody
    • Transcription factor HNF4 antibody
    see all

Anti-HNF-4-alpha antibody [K9218] - ChIP Grade images

  • ICC/IF image of ab41898 stained HepG2 cells. The cells were 4% PFA fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab41898, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) (ab150113) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • Anti-HNF-4-alpha antibody [K9218] - ChIP Grade (ab41898) at 1 µg/ml + HepG2 (Human hepatocellular liver carcinoma cell line) Whole Cell Lysate at 10 µg

    Secondary
    Goat Anti-Mouse IgG H&L (HRP) preadsorbed (ab97040) at 1/5000 dilution
    developed using the ECL technique

    Performed under reducing conditions.

    Predicted band size : 53 kDa
    Observed band size : 53 kDa
    Additional bands at : 108 kDa,37 kDa. We are unsure as to the identity of these extra bands.

    Exposure time : 4 minutes
  • ab41898 staining HNF-4-alpha in human liver hepatocytes (10-20 ug/mL) by Immunohistochemistry, formalin-fixed paraffin embedded sections.

  • ab41898 staining HNF-4-alpha in Rat Intestine epithelial cell(10-20 ug/mL) by Immunohistochemistry, formalin-fixed paraffin embedded sections.

  • Immunohistochemical analysis of obese mouse colon tissue, staining HNF-4-alpha with ab41898 at 1/200 dilution.

  • Overlay histogram showing HepG2 cells stained with ab41898 (red line). The cells were fixed with methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum (ab7481) / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab41898, 2µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a significantly decreased signal in HepG2 cells fixed with 4% paraformaldehyde/permeabilized in 0.1% PBS-Tween used under the same conditions.

References for Anti-HNF-4-alpha antibody [K9218] - ChIP Grade (ab41898)

This product has been referenced in:
  • Choudhary RK  et al. Comparison of the transcriptomes of long-term label retaining-cells and control cells microdissected from mammary epithelium: an initial study to characterize potential stem/progenitor cells. Front Oncol 3:21 (2013). IHC-P ; Cow . Read more (PubMed: 23423481) »
  • Pennarossa G  et al. Brief demethylation step allows the conversion of adult human skin fibroblasts into insulin-secreting cells. Proc Natl Acad Sci U S A 110:8948-53 (2013). Human . Read more (PubMed: 23696663) »

See all 8 Publications for this product

Product Wall

Thank you for contacting us.


There is no BSA in our product antibody.

Our antibody is collected and refined from mouse ascites by precipitation with ammonium sulfate.

And then the precipitate is resolved in physiolog...

Read More
Application Immunoprecipitation
Sample Human Cell lysate - nuclear (HK2)
Total protein in input 10 µg
Specification HK2
Treatment 10ng/ml TGF-beta 1
Immuno-precipitation step Other - Dynabeads® Protein A
Username

Dr. Robert Jenkins

Verified customer

Submitted Apr 12 2013

Thank you for contacting us.

We are happy to help customers find the most suitable products for their research purposes; however we are not specialized in this particular field and do not want to recommend a product that may be unsuitable....

Read More
Application Western blot
Sample Human Cell lysate - whole cell (liver cancer)
Loading amount 20 µg
Specification liver cancer
Gel Running Conditions Reduced Denaturing (10%gel)
Blocking step Milk as blocking agent for 12 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C
Username

Abcam user community

Verified customer

Submitted Oct 12 2012

Application Immunocytochemistry/ Immunofluorescence
Sample Rat Cell (Liver Frozen Sections)
Specification Liver Frozen Sections
Fixative Acetone
Permeabilization No
Blocking step Serum as blocking agent for 30 minute(s) · Concentration: 10% · Temperature: 20°C
Username

Dr. Fabio Marongiu

Verified customer

Submitted Oct 12 2012

Application Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample Human Tissue sections (Liver)
Specification Liver
Fixative Paraformaldehyde
Antigen retrieval step Heat mediated - Buffer/Enzyme Used: TRIS-EDTA Buffer pH 9,0
Permeabilization Yes - Wash Buffer with tween from Dako
Username

Mr. Rudolf Jung

Verified customer

Submitted Aug 24 2012

We recently carried out Flow cytometry and updated the datasheets in December. Please Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles. Storing the antibody at 4deg for extended period (more than two weeks) could affect the ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"