Loading...
Products:Cardiovascular >> Blood >> Coagulation >> Extrinsic
If your product does not perform as described on this datasheet, we will refund or replace your product...
Read our guarantee »Anti-HNF4 antibody [K9218] - ChIP Grade
See all HNF4 products (8) ...
Mouse monoclonal [K9218] to HNF4 - ChIP Grade
Recognizes human HNF4 alpha 1-6.
WB, ELISA, IP, IHC-P, ICC/IF, Flow Cyt, ChIP, Gel supershift assaysmore details
Reacts with
Mouse, Rat, Human
Predicted to work with
Cow, Pig
Baculovirus-expressed recombinant fragment: MADYSAALDP AYTTLEFENV QVLTMGNDTS PSEGTNLNAP NSLGVSAL, corresponding to amino acids 3-49 of Human HNF4
MADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAP NSLGVSAL
Human liver hepatocytes and rat intestine epithelial cell.
Liquid
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
Physiological saline Preservative: 0.1% Sodium Azide
Concentration information loading...
Purified from ascites via ammonium sulfate fractionation.
Monoclonal
K9218
IgG2a
Metabolism >> Types of disease >> Heart disease
Metabolism >> Types of disease >> Cancer
Metabolism >> Types of disease >> Diabetes
Metabolism >> Pathways and Processes >> Mitochondrial Metabolism >> Cytochromes
Metabolism >> Pathways and Processes >> Metabolic signaling pathways >> Energy transfer pathways >> Energy Metabolism
Metabolism >> Pathways and Processes >> Metabolic signaling pathways >> Lipid and lipoprotein metabolism >> Lipases
Metabolism >> Pathways and Processes >> Metabolic signaling pathways >> Lipid and lipoprotein metabolism >> Cholesterol Metabolism
Metabolism >> Pathways and Processes >> Metabolic signaling pathways >> Lipid and lipoprotein metabolism >> Lipid metabolism
Cancer >> Cancer Metabolism >> Metabolic signaling pathway >> Metabolism of lipids and lipoproteins
Developmental Biology >> Organogenesis >> Gut development >> Liver development
Epigenetics and Nuclear Signaling >> ChIP'ing antibodies >> ChIP'ing antibodies
Cardiovascular >> Atherosclerosis >> Diabetes associated
Epigenetics and Nuclear Signaling >> Transcription >> Polymerase associated factors >> Pol II Transcription >> Other
Signal Transduction >> Metabolism >> Energy Metabolism
Cardiovascular >> Lipids / Lipoproteins >> Lipid Metabolism >> Cytochromes
Cardiovascular >> Lipids / Lipoproteins >> Lipid Metabolism >> Cholesterol Metabolism
Cardiovascular >> Blood >> Coagulation >> Extrinsic
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - HNF4 antibody [K9218] (ab41898)
(enlarge)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - HNF4 antibody [K9218] (ab41898)
(enlarge)
Immunocytochemistry/ Immunofluorescence-HNF4 antibody [K9218](ab41898)
(enlarge)
Our Abpromise guarantee covers the use of ab41898 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
WB: Use a concentration of 1 µg/ml. Detects a band of approximately 53 kDa (predicted molecular weight: 53 kDa).
ELISA: Use a concentration of 0.1 µg/ml.
IP: Use at an assay dependent dilution.
IHC-P: Use a concentration of 10 - 20 µg/ml.
ICC/IF: Use a concentration of 1 µg/ml.
Flow Cyt: Use 1-2µg for 106 cells.
ChIP: Use at an assay dependent dilution. PubMed: 20463007
GSA: Use at an assay dependent dilution.
Transcriptionally controlled transcription factor. Binds to DNA sites required for the transcription of alpha 1-antitrypsin, apolipoprotein CIII, transthyretin genes and HNF1-alpha. May be essential for development of the liver, kidney and intestine.
Defects in HNF4A are the cause of maturity-onset diabetes of the young type 1 (MODY1) [MIM:125850]; also symbolized MODY-1. MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease.
Belongs to the nuclear hormone receptor family. NR2 subfamily.
Contains 1 nuclear receptor DNA-binding domain.
Phosphorylated on tyrosine residue(s); phosphorylation is important for its DNA-binding activity. Phosphorylation may directly or indirectly play a regulatory role in the subnuclear distribution.
Nucleus.
Target information above from: UniProt accessionP41235
The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - HNF4 antibody [K9218] (ab41898)
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - HNF4 antibody [K9218] (ab41898)](/ps/datasheet/Images/41/ab41898/ab41898_a.jpg)
ab41898 staining HNF4 in human liver hepatocytes (10-20 ug/mL) by Immunohistochemistry, formalin-fixed paraffin embedded sections.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - HNF4 antibody [K9218] (ab41898)
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - HNF4 antibody [K9218] (ab41898)](/ps/datasheet/Images/41/ab41898/ab41898_b.jpg)
ab41898 staining HNF4 in Rat Intestine epithelial cell(10-20 ug/mL) by Immunohistochemistry, formalin-fixed paraffin embedded sections.
Immunocytochemistry/ Immunofluorescence-HNF4 antibody [K9218](ab41898)
](/ps/datasheet/images/41/ab41898/HNF4-Primary-antibodies-ab41898-1.jpg)
ICC/IF image of ab41898 stained HepG2 cells. The cells were 4% PFA fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab41898, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
Western blot - HNF4 antibody [K9218] - ChIP Grade (ab41898)
![Western blot - HNF4 antibody [K9218] - ChIP Grade (ab41898)](/ps/datasheet/images/41/ab41898/HNF4-Primary-antibodies-ab41898-3.jpg)
Anti-HNF4 antibody [K9218] - ChIP Grade (ab41898) at 1 µg/ml + HepG2 (Human hepatocellular liver carcinoma cell line) Whole Cell Lysate at 10 µg
Secondary
Goat polyclonal Secondary Antibody to Mouse IgG - H&L (HRP), pre-adsorbed (ab97040) at 1/5000 dilution
developed using the ECL technique
Performed under reducing conditions.
Predicted band size : 53 kDa
Observed band size : 53 kDa
Additional bands at : 108 kDa,37 kDa. We are unsure as to the identity of these extra bands.
Exposure time : 4 minutes
Flow Cytometry-HNF4 antibody [K9218] - ChIP Grade(ab41898)
![Flow Cytometry-HNF4 antibody [K9218] - ChIP Grade(ab41898)](/ps/datasheet/images/41/ab41898/HNF4-Primary-antibodies-ab41898-4.jpg)
Overlay histogram showing HepG2 cells stained with ab41898 (red line). The cells were fixed with methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab41898, 2µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a significantly decreased signal in HepG2 cells fixed with 4% paraformaldehyde/permeabilized in 0.1% PBS-Tween used under the same conditions.
This product has been referenced in:
See all 3 publications for this product
Publishing research using ab41898? Please let us know so that we can cite the reference in this datasheet
Concentration of lot no. is
Concentration not available for this lot.
Find concentration of your lot:
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - HNF4 antibody [K9218] (ab41898)](/ps/datasheet/Images/41/ab41898/ab41898_a.jpg)
ab41898 staining HNF4 in human liver hepatocytes (10-20 ug/mL) by Immunohistochemistry, formalin-fixed paraffin embedded sections.
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - HNF4 antibody [K9218] (ab41898)](/ps/datasheet/Images/41/ab41898/ab41898_b.jpg)
ab41898 staining HNF4 in Rat Intestine epithelial cell(10-20 ug/mL) by Immunohistochemistry, formalin-fixed paraffin embedded sections.
](/ps/datasheet/images/41/ab41898/HNF4-Primary-antibodies-ab41898-1.jpg)
ICC/IF image of ab41898 stained HepG2 cells. The cells were 4% PFA fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab41898, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
![Flow Cytometry-HNF4 antibody [K9218] - ChIP Grade(ab41898)](/ps/datasheet/images/41/ab41898/HNF4-Primary-antibodies-ab41898-4.jpg)
Overlay histogram showing HepG2 cells stained with ab41898 (red line). The cells were fixed with methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab41898, 2µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (
0
Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
Call 01223 696 000 or contact us
