You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Anti-HNF4 antibody [K9218] - ChIP Grade (ab41898)

CodeSizePriceAbpointsAvailability
    
 
  • -

  •   
  •   
  •   
  •  

  •  
  •  
  •  

  •  
Updating...

Reassurance, Refunds & Replacements

If your product does not perform as described on this datasheet, we will refund or replace your product...

Read our guarantee »

Overview

Product name

Anti-HNF4 antibody [K9218] - ChIP Grade
See all HNF4 products (8) ...

Description

Mouse monoclonal [K9218] to HNF4 - ChIP Grade

Specificity

Recognizes human HNF4 alpha 1-6.

Tested applications

WB, ELISA, IP, IHC-P, ICC/IF, Flow Cyt, ChIP, Gel supershift assaysmore details

Cross reactivity

Reacts with

Mouse, Rat, Human

Predicted to work with

Cow, Pig

Immunogen

Baculovirus-expressed recombinant fragment: MADYSAALDP AYTTLEFENV QVLTMGNDTS PSEGTNLNAP NSLGVSAL, corresponding to amino acids 3-49 of Human HNF4

MADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAP NSLGVSAL

Positive control

Human liver hepatocytes and rat intestine epithelial cell.

Properties

Form

Liquid

Storage instructions

Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.

Storage buffer

Physiological saline Preservative: 0.1% Sodium Azide

Concentration

Concentration information loading...

Purification notes

Purified from ascites via ammonium sulfate fractionation.

Clonality

Monoclonal

Clone number

K9218

Isotype

IgG2a

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - HNF4 antibody [K9218] (ab41898)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - HNF4 antibody [K9218] (ab41898) image (enlarge)

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - HNF4 antibody [K9218] (ab41898)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - HNF4 antibody [K9218] (ab41898) image (enlarge)

  • Immunocytochemistry/ Immunofluorescence-HNF4 antibody [K9218](ab41898)Immunocytochemistry/ Immunofluorescence-HNF4 antibody [K9218](ab41898) image (enlarge)

Applications

Show applications key

Our Abpromise guarantee covers the use of ab41898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Target

Function

Transcriptionally controlled transcription factor. Binds to DNA sites required for the transcription of alpha 1-antitrypsin, apolipoprotein CIII, transthyretin genes and HNF1-alpha. May be essential for development of the liver, kidney and intestine.

Involvement in disease

Defects in HNF4A are the cause of maturity-onset diabetes of the young type 1 (MODY1) [MIM:125850]; also symbolized MODY-1. MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease.

Sequence similarities

Belongs to the nuclear hormone receptor family. NR2 subfamily.
Contains 1 nuclear receptor DNA-binding domain.

Post-translational
modifications

Phosphorylated on tyrosine residue(s); phosphorylation is important for its DNA-binding activity. Phosphorylation may directly or indirectly play a regulatory role in the subnuclear distribution.

Cellular localization

Nucleus.

Target information above from: UniProt accessionP41235 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010).

Information by UniProt

Alternative names

  • FLJ39654 antibody
  • Hepatic nuclear factor 4 alpha antibody
  • Hepatocyte nuclear factor 4 alpha antibody
  • Hepatocyte nuclear factor 4 antibody
  • Hepatocyte nuclear factor 4-alpha antibody
  • HNF 4 alpha antibody
  • HNF 4 antibody
  • HNF-4-alpha antibody
  • HNF4 antibody
  • HNF4 antibody
  • HNF4A antibody
  • HNF4A_HUMAN antibody
  • HNF4a7 antibody
  • HNF4a8 antibody
  • HNF4a9 antibody
  • Hnf4alpha antibody
  • MODY 1 antibody
  • MODY antibody
  • MODY1 antibody
  • NR2A1 antibody
  • NR2A1 antibody
  • NR2A21 antibody
  • Nuclear receptor subfamily 2 group A member 1 antibody
  • OTTHUMP00000031060 antibody
  • OTTHUMP00000031062 antibody
  • TCF 14 antibody
  • TCF antibody
  • TCF-14 antibody
  • TCF14 antibody
  • TCF14 antibody
  • Tcf4 antibody
  • Transcription factor 14, hepatic nuclear factor antibody
  • Transcription factor 14 antibody
  • Transcription factor HNF 4 antibody
  • Transcription factor HNF-4 antibody
  • Transcription factor HNF4 antibody
see all

Anti-HNF4 antibody [K9218] - ChIP Grade images:

  Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - HNF4 antibody [K9218] (ab41898)

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - HNF4 antibody [K9218] (ab41898)

ab41898 staining HNF4 in human liver hepatocytes (10-20 ug/mL) by Immunohistochemistry, formalin-fixed paraffin embedded sections.

  Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - HNF4 antibody [K9218] (ab41898)

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - HNF4 antibody [K9218] (ab41898)

ab41898 staining HNF4 in Rat Intestine epithelial cell(10-20 ug/mL) by Immunohistochemistry, formalin-fixed paraffin embedded sections.

  Immunocytochemistry/ Immunofluorescence-HNF4 antibody [K9218](ab41898)

Immunocytochemistry/ Immunofluorescence-HNF4 antibody [K9218](ab41898)

ICC/IF image of ab41898 stained HepG2 cells. The cells were 4% PFA fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab41898, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  Western blot - HNF4 antibody [K9218] - ChIP Grade (ab41898)

Western blot - HNF4 antibody [K9218] - ChIP Grade (ab41898)

Anti-HNF4 antibody [K9218] - ChIP Grade (ab41898) at 1 µg/ml + HepG2 (Human hepatocellular liver carcinoma cell line) Whole Cell Lysate at 10 µg

Secondary
Goat polyclonal Secondary Antibody to Mouse IgG - H&L (HRP), pre-adsorbed (ab97040) at 1/5000 dilution
developed using the ECL technique

Performed under reducing conditions.

Predicted band size : 53 kDa
Observed band size : 53 kDa
Additional bands at : 108 kDa,37 kDa. We are unsure as to the identity of these extra bands.

Exposure time : 4 minutes

  Flow Cytometry-HNF4 antibody [K9218] - ChIP Grade(ab41898)

Flow Cytometry-HNF4 antibody [K9218] - ChIP Grade(ab41898)

Overlay histogram showing HepG2 cells stained with ab41898 (red line). The cells were fixed with methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab41898, 2µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a significantly decreased signal in HepG2 cells fixed with 4% paraformaldehyde/permeabilized in 0.1% PBS-Tween used under the same conditions.

References for Anti-HNF4 antibody [K9218] - ChIP Grade (ab41898)

This product has been referenced in:

  • de Boussac H  et al. The ERK1/2-hepatocyte nuclear factor 4alpha axis regulates human ABCC6 gene expression in hepatocytes. J Biol Chem 285:22800-8 (2010). ChIP; Human.Read more (PubMed: 20463007) »
  • Haase A  et al. Generation of induced pluripotent stem cells from human cord blood. Cell Stem Cell 5:434-41 (2009). ICC/IF; Human.Read more (PubMed: 19796623) »

See all 3 publications for this product

Publishing research using ab41898? Please let us know so that we can cite the reference in this datasheet

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"