Overview

  • Product nameAnti-Homez antibody
    See all Homez primary antibodies
  • Description
    Rabbit polyclonal to Homez
  • Tested applicationsSuitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 72-121 (

    KTFSYFPYPSLADIALLCLRYGLQMEKVKTWFMAQRLRCGISWSSEEIEE

    ) of human HOMEZ (NP_065885).

  • Positive control
    • 721_B cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab82867 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay, 1:1562500.

WB Use a concentration of 1 µg/ml. Predicted molecular weight: 59 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-Homez antibody images

  • Anti-Homez antibody (ab82867) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG diluted in 1/50000 - 1/100000 as secondary antibody.

    Predicted band size : 59 kDa
    Observed band size : 59 kDa
    Additional bands at : 36 kDa,<22 kDa. We are unsure as to the identity of these extra bands.

References for Anti-Homez antibody (ab82867)

ab82867 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82867.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"