Overview

  • Product name
  • Description
    Mouse polyclonal to HOXA13
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment (proprietary-tag) corresponding to Human HOXA13 aa 208-306. NP_000513.2.
    Sequence:

    DKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPG LGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTL


    Database link: P31271

  • Positive control
    • HL60 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab194345 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 39 kDa.

Target

  • Function
    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Involvement in disease
    Defects in HOXA13 are the cause of hand-foot-genital syndrome (HFGS) [MIM:140000]; also known as hand-foot-uterus syndrome. The clinical features include small feet with unusually short great toes and abnormal thumbs. Females with the disorder have duplication of the genital tract.
    Defects in HOXA13 are the cause of Guttmacher syndrome (GUTTS) [MIM:176305]. Guttmacher syndrome is a dominantly inherited combination of distal limb and genital tract abnormalities. It has several features in common with hand-foot-genital syndrome, including hypoplastic first digits and hypospadias. Typical features not seen in hand-foot-genital syndrome include postaxial polydactyly of the hands and uniphalangeal second toes with absent nails.
  • Sequence similarities
    Belongs to the Abd-B homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Form
    This protein has also been described in cytoplasm.
  • Alternative names
    • Homeo box 1J antibody
    • Homeo box A13 antibody
    • Homeobox 1J antibody
    • Homeobox A13 antibody
    • Homeobox protein Hox A13 antibody
    • Homeobox protein Hox-1J antibody
    • Homeobox protein Hox-A13 antibody
    • Homeobox protein HOXA13 antibody
    • Homeobox1J antibody
    • HomeoboxA13 antibody
    • HOX 1 antibody
    • HOX 1J antibody
    • Hox 1J protein antibody
    • HOX A13 antibody
    • HOX1 antibody
    • HOX1J antibody
    • HOXA 13 antibody
    • HOXA13 antibody
    • HXA13_HUMAN antibody
    • Transcription factor HOXA13 antibody
    see all

Images

  • Anti-HOXA13 antibody (ab194345) at 1/500 dilution + HL60 cell lysate at 50 µg

    Secondary
    Goat Anti-Mouse IgG (H+L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 39 kDa

References

ab194345 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194345.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up