Overview

  • Product nameAnti-HOXA9 antibody
    See all HOXA9 primary antibodies
  • Description
    Rabbit polyclonal to HOXA9
  • Tested applicationsSuitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Chicken, Dog, Human, Chimpanzee, Rhesus monkey
    Predicted to work with: Zebrafish, Shark
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 180 - 230 (AENESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFN MY) of Human HOXA9 (NP_689952).

  • Positive control
    • Human brain tissue

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferPreservative: 0.05% Sodium Azide
    Constituents: 0.05% BSA, PBS
  • Concentration information loading...
  • PurityProtein A purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab92565 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P
  • Application notesIHC-P: Use at a concentration of 5 µg/ml for 45 mins at RT. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • FunctionSequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
    • Involvement in diseaseNote=A chromosomal aberration involving HOXA9 is found in a form of acute myeloid leukemia. Translocation t(7;11)(p15;p15) with NUP98.
      Note=A chromosomal aberration involving HOXA9 may contribute to disease progression in chronic myeloid leukemia. Translocation t(7;17)(p15;q23) with MSI2.
    • Sequence similaritiesBelongs to the Abd-B homeobox family.
      Contains 1 homeobox DNA-binding domain.
    • Cellular localizationNucleus.
    • Information by UniProt
    • Database links
    • FormHOXA9 is a transcription factor with a central role in both haemopoiesis and leukaemia. High levels of HOXA9 expression in haemopoietic cells is a characteristic feature of acute myeloid leukaemia (AML), and may be sufficient to cause this disease. Overexpression of Hoxa 9 markedly expands hematopoietic stem cells.
    • Alternative names
      • ABD-B antibody
      • Abd-B, drosophila, homolog of antibody
      • D6a9 antibody
      • Homeobox 1G antibody
      • Homeobox A9 antibody
      • Homeobox protein Hox-1.7 antibody
      • Homeobox protein Hox-1G antibody
      • Homeobox protein Hox-A9 antibody
      • Homeodomain protein HOXA9 antibody
      • Hox-1.7 antibody
      • Hox-1.7, mouse, homolog of antibody
      • HOX1 antibody
      • Hox1.7 antibody
      • Hox1G antibody
      • Hox1r5 antibody
      • Hoxa-9 antibody
      • Hoxa7 antibody
      • HOXA9 antibody
      • HOXA9/MSI2 fusion gene, included antibody
      • HOXA9/NUP98 fusion gene, included antibody
      • HXA9_HUMAN antibody
      • MGC1934 antibody
      see all

    Anti-HOXA9 antibody images

    • Immunohistochemistry analysis of formalin-fixed, paraffin-embedded Human brain tissue using an isotype control (1) or ab92565 at 5µg/ml (2).

    References for Anti-HOXA9 antibody (ab92565)

    ab92565 has not yet been referenced specifically in any publications.

    Product Wall


    I am very pleased to hear you would like to accept our offer and test ab92565 in WB. This code will give you 1 freeprimary antibodybefore the expiration date. To redeem this offer, please submit an Abreview forwestern blottingand include this code...

    Read More

    Thank you for contacting us. Because we carry over 70,000 products, it isn't feasible for us to keep small sample sizes of our products. We are happy to reassure our customers that all of our products are covered by our Abpromise, which guarantees ...

    Read More

    Thank you for contacting us. Because we carry over 70,000 products, it isn't feasible for us to keep small sample sizes of our products. We are happy to reassure our customers that all of our products are covered by our Abpromise, which guarantees ...

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"