Overview

  • Product name
    Anti-HOXB4 antibody [3A2F2]
    See all HOXB4 primary antibodies
  • Description
    Mouse monoclonal [3A2F2] to HOXB4
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human HOXB4 aa 16-251. (Purified from E.coli).
    Sequence:

    KFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAACTVQRY AACRDPGPPPPPPPPPPPPPPPGLSPRAPAPPPAGALLPEPGQRCEAVSS SPPPPPCAQNPLHPSPSHSACKEPVVYPWMRKVHVSTVNPNYAGGEPKRS RTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRM KWKKDHKLPNTKIRSGGAAGSAGGPPGRPNGGPRAL


    Database link: P17483

  • Positive control
    • Human HOXB4 (aa16-251) recombinant protein; HOXB4 (aa16-251)-hIgGFc transfected HEK293 cell lysate; Human rectum cancer and colon cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab201957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 28 kDa.
IHC-P 1/200 - 1/1000.

Target

  • Function
    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Sequence similarities
    Belongs to the Antp homeobox family. Deformed subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stage
    Expressed in whole embryos and fetuses at 5-9 weeks from conception.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Homeo box 2F antibody
    • Homeo box B4 antibody
    • Homeobox 2F antibody
    • Homeobox B4 antibody
    • Homeobox protein Hox B4 antibody
    • Homeobox protein Hox-2.6 antibody
    • Homeobox protein Hox-2F antibody
    • Homeobox protein Hox-B4 antibody
    • Homeobox protein HoxB4 antibody
    • HOX 2 antibody
    • Hox 2.6 antibody
    • Hox 2F antibody
    • HOX B4 antibody
    • HOX2 antibody
    • Hox2.6 antibody
    • Hox2F antibody
    • HOXB 4 antibody
    • hoxb4 antibody
    • HXB4_HUMAN antibody
    see all

Images

  • Anti-HOXB4 antibody [3A2F2] (ab201957) at 1/500 dilution + Human HOXB4 (aa16-251) recombinant protein

    Predicted band size: 28 kDa



    Expected MWt is 51.9 kDa.

  • All lanes : Anti-HOXB4 antibody [3A2F2] (ab201957) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : HOXB4 (aa16-251)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 28 kDa

  • Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling HOXB4 with ab201957 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human colon cancer tissue labeling HOXB4 with ab201957 at 1/200 dilution.

References

ab201957 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up