Anti-HOXC4 antibody (ab24338)

Overview

  • Product nameAnti-HOXC4 antibody
    See all HOXC4 primary antibodies
  • Description
    Rabbit polyclonal to HOXC4
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Zebrafish
  • Immunogen

    A 14-22 amino acid region within synthetic peptide: MIMSSYLMDS NYIDPKFPPC EEYSQNSYIP EHSPEYYGRT RESGFQHHHQ, corresponding to amino acids 1-50 of Human HOXC4

  • Positive control
    • Fetal liver lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab24338 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 µg/ml. Detects a band of approximately 30 kDa (predicted molecular weight: 30 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-HOXC4 antibody images

  • Anti-HOXC4 antibody (ab24338) at 2 µg/ml + Human fetal liver lysate.

    Secondary
    HRP-conjugated anti-Rabbit IgG at 1/50000 - 1/100000 dilution

    Predicted band size : 30 kDa
    Observed band size : 30 kDa

References for Anti-HOXC4 antibody (ab24338)

ab24338 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your enquiry. I have been in touch with the source of this antibody and I can tell you that the immunogen sequence used to raise ab24338 was: MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQ I hope this information helps, plea...

Read More
Abcam guarantees this product to work in the species/application used in this Abreview.
Application Western blot
Sample Human Tissue lysate - whole (prostate tumour)
Loading amount 15 µg
Specification prostate tumour
Blocking step BSA as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 4%
Username

Dr. Richard Morgan

Verified customer

Submitted Mar 13 2006

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"