Overview

  • Product nameAnti-HPRT antibody
    See all HPRT primary antibodies
  • Description
    Rabbit polyclonal to HPRT
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Chimpanzee, Zebrafish
  • Immunogen

    Synthetic peptide derived from within residues DQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKM corresponding to amino acids 109-158 of human HPRT1 (NP_000185)

  • Positive control
    • HeLa cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab81059 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:12500.

Target

  • FunctionConverts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway.
  • PathwayPurine metabolism; IMP biosynthesis via salvage pathway; IMP from hypoxanthine: step 1/1.
  • Involvement in diseaseDefects in HPRT1 are the cause of Lesch-Nyhan syndrome (LNS) [MIM:300322]. LNS is characterized by complete lack of enzymatic activity that results in hyperuricemia, choreoathetosis, mental retardation, and compulsive self-mutilation.
    Defects in HPRT1 are the cause of gout HPRT-related (GOUT-HPRT) [MIM:300323]; also known as HPRT-related gout or Kelley-Seegmiller syndrome. Gout is characterized by partial enzyme activity and hyperuricemia.
  • Sequence similaritiesBelongs to the purine/pyrimidine phosphoribosyltransferase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • HGPRT antibody
    • HGPRTase antibody
    • HPRT 1 antibody
    • HPRT_HUMAN antibody
    • HPRT1 antibody
    • Hypoxanthine guanine phosphoribosyltransferase antibody
    • Hypoxanthine phosphoribosyltransferase 1 (Lesch Nyhan syndrome) antibody
    • Hypoxanthine phosphoribosyltransferase 1 antibody
    • Hypoxanthine-guanine phosphoribosyltransferase antibody
    see all

Anti-HPRT antibody images

  • Anti-HPRT antibody (ab81059) at 1 µg/ml (in 5% skim milk / PBS buffer) + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 24 kDa
    Observed band size : 29 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 62 kDa. We are unsure as to the identity of these extra bands.

References for Anti-HPRT antibody (ab81059)

ab81059 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81059.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"