Overview

  • Product nameAnti-HPS6 antibody
    See all HPS6 primary antibodies
  • Description
    Rabbit polyclonal to HPS6
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Amino acids 405-466 of Human HPS6 (NP_079023)

    EEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTM LRTELRDYRGLE

  • Positive control
    • H1299, HeLa and HepG2 cell lines. A431 whole cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage bufferPreservative: 0.01% Thimerosal (merthiolate)
    Constituents: 10% Glycerol, 0.1M Tris, 0.1M Glycine, pH 7.0
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab96656 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 83 kDa.

Target

  • FunctionMay regulate the synthesis and function of lysosomes and of highly specialized organelles, such as melanosomes and platelet dense granules.
  • Tissue specificityUbiquitous.
  • Involvement in diseaseDefects in HPS6 are the cause of Hermansky-Pudlak syndrome type 6 (HPS6) [MIM:614075]. Hermansky-Pudlak syndrome (HPS) is a genetically heterogeneous, rare, autosomal recessive disorder characterized by oculocutaneous albinism, bleeding due to platelet storage pool deficiency, and lysosomal storage defects. This syndrome results from defects of diverse cytoplasmic organelles including melanosomes, platelet dense granules and lysosomes. Ceroid storage in the lungs is associated with pulmonary fibrosis, a common cause of premature death in individuals with HPS.
  • Cellular localizationMicrosome membrane. Cytoplasm > cytosol. Early endosome membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ22501 antibody
    • Hermansky Pudlak syndrome 6 protein antibody
    • Hermansky-Pudlak syndrome 6 protein antibody
    • HPS6 antibody
    • HPS6_HUMAN antibody
    • MGC20522 antibody
    • Ru antibody
    • Ruby eye protein homolog antibody
    • Ruby-eye protein homolog antibody
    see all

Anti-HPS6 antibody images

  • Anti-HPS6 antibody (ab96656) at 1/1000 dilution + A431 whole cell lysate at 30 µg

    Predicted band size : 83 kDa

References for Anti-HPS6 antibody (ab96656)

ab96656 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab96656.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"