Overview

  • Product name
  • Description
    Rabbit polyclonal to HPS6
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Amino acids 405-466 of Human HPS6 (NP_079023)

    EEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTM LRTELRDYRGLE

  • Positive control
    • H1299, HeLa and HepG2 cell lines. A431 whole cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.01% Thimerosal (merthiolate)
    Constituents: 10% Glycerol, 0.1M Tris, 0.1M Glycine, pH 7.0
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab96656 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 83 kDa.

Target

  • Function
    May regulate the synthesis and function of lysosomes and of highly specialized organelles, such as melanosomes and platelet dense granules.
  • Tissue specificity
    Ubiquitous.
  • Involvement in disease
    Defects in HPS6 are the cause of Hermansky-Pudlak syndrome type 6 (HPS6) [MIM:614075]. Hermansky-Pudlak syndrome (HPS) is a genetically heterogeneous, rare, autosomal recessive disorder characterized by oculocutaneous albinism, bleeding due to platelet storage pool deficiency, and lysosomal storage defects. This syndrome results from defects of diverse cytoplasmic organelles including melanosomes, platelet dense granules and lysosomes. Ceroid storage in the lungs is associated with pulmonary fibrosis, a common cause of premature death in individuals with HPS.
  • Cellular localization
    Microsome membrane. Cytoplasm > cytosol. Early endosome membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • BLOC2S3 antibody
    • FLJ22501 antibody
    • Hermansky Pudlak syndrome 6 protein antibody
    • Hermansky-Pudlak syndrome 6 protein antibody
    • HPS6 antibody
    • HPS6 biogenesis of lysosomal organelles complex 2 subunit 3 antibody
    • HPS6_HUMAN antibody
    • MGC20522 antibody
    • Ru antibody
    • Ruby eye protein homolog antibody
    • Ruby-eye protein homolog antibody
    see all

Images

  • Anti-HPS6 antibody (ab96656) at 1/1000 dilution + A431 whole cell lysate at 30 µg

    Predicted band size : 83 kDa

References

ab96656 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab96656.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up