Overview

  • Product name
  • Description
    Rabbit polyclonal to HRP2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HRP2 aa 409-487.
    Sequence:

    AKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFS MDRKVEKKKEPSVEEKLQKLHSEIKFALK


    Database link: Q7Z4V5

  • Positive control
    • Human stomach, upper tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab184988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Sequence similarities
    Belongs to the HDGF family.
    Contains 1 PWWP domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt
  • Database links
  • Alternative names
    • HDGF-2 antibody
    • HDGF2 antibody
    • Hdgfrp2 antibody
    • HDGR2_HUMAN antibody
    • Hepatoma-derived growth factor 2 antibody
    • Hepatoma-derived growth factor antibody
    • Hepatoma-derived growth factor-related protein 2 antibody
    • heptoma derived growth factor related protein 2 antibody
    • HRP-2 antibody
    see all

Images

  • Immunohistochemical analysis of Human stomach, upper tissue labeling HRP2 with ab184988 at 1/1000 dilution.

References

ab184988 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up