Anti-HSD17B13 antibody (ab122036)
Key features and details
- Rabbit polyclonal to HSD17B13
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-HSD17B13 antibody
See all HSD17B13 primary antibodies -
Description
Rabbit polyclonal to HSD17B13 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human HSD17B13 aa 119-247.
Sequence:NNAGTVYPADLLSTKDEEITKTFEVNILGHFWITKALLPSMMERNHGHIV TVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTGIKTSCLCP VFVNTGFTKNPSTRLWPVLETDEVVRSLI
-
Positive control
- IHC: Human liver and skin tissue sections; ICC/IF: Human cell line U-251MG.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab122036 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use a concentration of 0.25 - 2 µg/ml.
|
|
IHC-P |
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
ICC/IF
Use a concentration of 0.25 - 2 µg/ml. |
IHC-P
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Tissue specificity
Highly expressed in the liver. Also detected in ovary, bone marrow, kidney, brain, lung, skeletal muscle, bladder and testis. -
Sequence similarities
Belongs to the short-chain dehydrogenases/reductases (SDR) family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 345275 Human
- Omim: 612127 Human
- SwissProt: Q7Z5P4 Human
- Unigene: 284414 Human
-
Alternative names
- 17-beta-HSD 13 antibody
- 17-beta-hydroxysteroid dehydrogenase 13 antibody
- DHB13_HUMAN antibody
see all
Images
-
Immunohistochemical analysis of human liver tissue labeling HSD17B13 with ab122036 at 1/200 dilution. Moderate to strong granular cytoplasmic positivity in hepatocytes is shown.
-
Immunofluorescent staining of Human cell line U-251MG shows positivity in golgi apparatus and vesicles. Recommended concentration of ab122036 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
Immunohistochemical analysis of human skin tissue labeling HSD17B13 with ab122036 at 1/200 dilution. Moderate granular cytoplasmic positivity in basal epidermal cells is shown.
-
Immunohistochemical analysis of human tonsil tissue labeling HSD17B13 with ab122036 at 1/200 dilution. As expected, no positivity in lymphoid cells is shown.
-
Immunohistochemical analysis of human placenta tissue labeling HSD17B13 with ab122036 at 1/500 dilution. As expected, no positivity in trophoblastic cells is shown.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab122036 has been referenced in 2 publications.
- Su W et al. Liver X receptor a induces 17ß-hydroxysteroid dehydrogenase-13 expression through SREBP-1c. Am J Physiol Endocrinol Metab 312:E357-E367 (2017). PubMed: 28270440
- Su W et al. Comparative proteomic study reveals 17ß-HSD13 as a pathogenic protein in nonalcoholic fatty liver disease. Proc Natl Acad Sci U S A 111:11437-42 (2014). Human . PubMed: 25028495