Overview

  • Product name
    Anti-HSF1 antibody [10H4] (FITC)
    See all HSF1 primary antibodies
  • Description
    Rat monoclonal [10H4] to HSF1 (FITC)
  • Host species
    Rat
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Tested applications
    Suitable for: ELISA, WB, IP, ICCmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Rabbit, Guinea pig, Hamster, Cow, Human, Monkey
  • Immunogen

    Recombinant full length protein corresponding to Mouse HSF1 aa 1-525.
    Sequence:

    MDLAVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQG QFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQ HPCFLRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTRLLTDVQLMKGK QECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLVQSN RILGVKRKIPLMLSDSNSAHSVPKYGRQYSLEHVHGPGPYSAPSPAYSSS SLYSSDAVTSSGPIISDITELAPTSPLASPGRSIDERPLSSSTLVRVKQE PPSPPHSPRVLEASPGRPSSMDTPLSPTAFIDSILRESEPTPAASNTAPM DTTGAQAPALPTPSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLTS HGFSVDTSALLDLFSPSVTMPDMSLPDLDSSLASIQELLSPQEPPRPIEA ENSNPDSGKQLVHYTAQPLFLLDPDAVDTGSSELPVLFELGESSYFSEGD DYTDDPTISLLTGTEPHKAKDPTVS


    Database link: P38532

  • Epitope
    Amino acids 378-395
  • Positive control
    • Heat shocked HeLa cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab186349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.
WB 1/1000. Predicted molecular weight: 57 kDa.

Detects an ~85 kDa protein in unstressed cell lysates, and an ~95 kDa protein in heat shocked cell lysates, corresponding to the molecular mass of inactive and active forms of HSF1 on SDS-PAGE immunoblots.

IP Use at an assay dependent concentration.
ICC Use at an assay dependent concentration.
EMSA Use at an assay dependent concentration.

Target

  • Function
    DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. In higher eukaryotes, HSF is unable to bind to the HSE unless the cells are heat shocked.
  • Sequence similarities
    Belongs to the HSF family.
  • Domain
    the 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.
  • Post-translational
    modifications
    Phosphorylated on multiple serine residues, a subset of which are involved in stress-related regulation of transcription activation. Constitutive phosphorylation represses transcriptional activity at normal temperatures. Levels increase on specific residues heat-shock and enhance HSF1 transactivation activity. Phosphorylation on Ser-307 derepresses activation on heat-stress and in combination with Ser-303 phosphorylation appears to be involved in recovery after heat-stress. Phosphorylated on Ser-230 by CAMK2, in vitro. Cadmium also enhances phosphorylation at this site. Phosphorylation on Ser-303 is a prerequisite for HSF1 sumoylation. Phosphorylation on Ser-121 inhibits transactivation and promotes HSP90 binding. Phosphorylation on Thr-142 also mediates transcriptional activity induced by heat. Phosphorylation on Ser-326 plays an important role in heat activation of HSF1 transcriptional activity.
    Sumoylated with SUMO1 and SUMO2 on heat-shock. Heat-inducible sumoylation occurs after 15 min of heat-shock, after which levels decrease and at 4 hours, levels return to control levels. Sumoylation has no effect on HSE binding nor on transcriptional activity. Phosphorylation on Ser-303 is a prerequisite for sumoylation.
  • Cellular localization
    Cytoplasm. Nucleus. Cytoplasmic during normal growth. On activation, translocates to nuclear stress granules. Colocalizes with SUMO1 in nuclear stress granules.
  • Information by UniProt
  • Database links
  • Alternative names
    • Heat shock factor 1 antibody
    • Heat shock factor protein 1 antibody
    • Heat shock transcription factor 1 antibody
    • HSF 1 antibody
    • hsf1 antibody
    • HSF1_HUMAN antibody
    • HSTF 1 antibody
    • HSTF1 antibody
    see all

References

ab186349 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186349.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up