Overview

  • Product nameAnti-HSF4 antibody
    See all HSF4 primary antibodies
  • Description
    Mouse polyclonal to HSF4
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
  • Immunogen

    Fusion protein:

    QSPSPCSPSQRPRWASALTGPEGPSSLTSQKILHLLKDTGFLPPVVAGAP PPLPVAVVQAILEGKGSYSPEGPRSVQQPEPRGPREVPDRGTLGLDRGNR

    , corresponding to amino acids 242/341 of Mouse HSF4.

  • General notesProduced from outbred CD1 mice


    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferConstituents: 50% Glycerol
  • PurityWhole antiserum
  • Primary antibody notesThis antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab21826 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 53 kDa.

This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.

Target

  • FunctionDNA-binding protein that specifically binds heat shock promoter elements (HSE). Isoform HSF4A represses transcription while the isoform HSF4B activates transcription.
  • Tissue specificityExpressed in heart, skeletal muscle, eye and brain, and at much lower levels in some other tissues.
  • Involvement in diseaseDefects in HSF4 are the cause of cataract zonular HSF4-related (CZ-HSF4) [MIM:116800]. A form of zonular cataract. Zonular or lamellar cataracts are opacities, broad or narrow, usually consisting of powdery white dots affecting only certain layers or zones between the cortex and nucleus of an otherwise clear lens. The opacity may be so dense as to render the entire central region of the lens completely opaque, or so translucent that vision is hardly if at all impeded. Zonular cataracts generally do not involve the embryonic nucleus, though sometimes they involve the fetal nucleus. Usually sharply separated from a clear cortex outside them, they may have projections from their outer edges known as riders or spokes.
    Defects in HSF4 are the cause of cataract Marner type (CAM) [MIM:116800]. A form of cataract with variable and progressive opacities. Affected individuals present with zonular cataract, although some have nuclear, anterior polar, or stellate cataract. Finger malformation is observed in some kindreds.
  • Sequence similaritiesBelongs to the HSF family.
  • Post-translational
    modifications
    Phosphorylated mainly on serine residues. Phosphorylation on Ser-298 promotes sumoylation on Lys-293.
    Isoform HSF4B is constitutively sumoylated. Sumoylation represses the transcriptional activity and is promoted by phosphorylation on Ser-298. HSFA is not sumoylated.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cataract, Marner antibody
    • CTM antibody
    • Heat shock factor protein 4 antibody
    • Heat shock transcription factor 4 antibody
    • hHSF4 antibody
    • HSF 4 antibody
    • HSF4 antibody
    • HSF4_HUMAN antibody
    • HSTF 4 antibody
    see all

Anti-HSF4 antibody images

  • All lanes : Anti-HSF4 antibody (ab21826) at 1/1000 dilution

    Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
    Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug

    Secondary
    Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution

    Predicted band size : 53 kDa
    Observed band size : 38 kDa (why is the actual band size different from the predicted?)

References for Anti-HSF4 antibody (ab21826)

ab21826 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab21826.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"