Overview

  • Product name
    Anti-HSFY2 antibody
  • Description
    Rabbit polyclonal to HSFY2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cat
  • Immunogen

    Synthetic peptide within Human HSFY2 aa 51-100 (internal sequence). The exact sequence is proprietary.
    Sequence:

    LSQGSLLESPSYTVCVSEPDKDDDFLSLNFPRKLWKIVESDQFKSISWDE


    Database link: Q96LI6-3

  • Positive control
    • Jurkat whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab179421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa.

Target

  • Tissue specificity
    Testis-specific. Present in Sertoli cells and spermatogenic cells (at protein level).
  • Sequence similarities
    Belongs to the HSF family.
  • Cellular localization
    Nucleus. Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ25453 antibody
    • Heat shock transcription factor 2-like protein antibody
    • Heat shock transcription factor antibody
    • heat shock transcription factor, Y-linked antibody
    • HSF2-like antibody
    • HSF2L antibody
    • HSFY antibody
    • HSFY1 antibody
    • HSFY1_HUMAN antibody
    • HSFY2 antibody
    • OTTHUMP00000038974 antibody
    • OTTHUMP00000038975 antibody
    • Y-linked antibody
    see all

Images

  • Anti-HSFY2 antibody (ab179421) at 1 µg/ml + Jurkat whole cell lysate at 10 µg

    Predicted band size : 24 kDa

References

ab179421 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179421.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up