Overview

  • Product nameAnti-Hsp70 antibody
    See all Hsp70 primary antibodies
  • Description
    Mouse monoclonal to Hsp70
  • Tested applicationsWB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Hsp70 aa 531-612.
    Sequence:

    VQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISW LDANTLAEKDEFEHKRKELEQVCNPIISGLY

Properties

Applications

Our Abpromise guarantee covers the use of ab55288 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 71 kDa.
IHC-P Use a concentration of 6 µg/ml.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • FunctionIn cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. In case of rotavirus A infection, serves as a post-attachment receptor for the virus to facilitate entry into the cell.
  • Tissue specificityHSPA1B is testis-specific.
  • Sequence similaritiesBelongs to the heat shock protein 70 family.
  • Cellular localizationCytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt
  • Database links
  • Alternative names
    • DnaK type molecular chaperone HSP70 1 antibody
    • Epididymis secretory protein Li 103 antibody
    • FLJ54303 antibody
    • FLJ54370 antibody
    • FLJ54392 antibody
    • FLJ54408 antibody
    • FLJ75127 antibody
    • Heat shock 70 kDa protein 1 antibody
    • Heat shock 70 kDa protein 1/2 antibody
    • Heat shock 70 kDa protein 1A/1B antibody
    • Heat shock 70kDa protein 1A antibody
    • Heat shock 70kDa protein 1B antibody
    • Heat shock induced protein antibody
    • HEL S 103 antibody
    • HSP70 1 antibody
    • HSP70 1B antibody
    • HSP70 2 antibody
    • HSP70-1/HSP70-2 antibody
    • HSP70-1A antibody
    • HSP70.1 antibody
    • HSP70.1/HSP70.2 antibody
    • HSP70I antibody
    • HSP71_HUMAN antibody
    • HSP72 antibody
    • HSPA1 antibody
    • HSPA1A antibody
    • HSPA1B antibody
    see all

Anti-Hsp70 antibody images

  • HSPA1B antibody (ab55288) used in immunohistochemistry at 6ug/ml on formalin fixed and paraffin embedded human testis.


  • Predicted band size : 71 kDa
    HSPA1B antibody (ab55288) at 1ug/lane + IMR-32 cell lysate at 25ug/lane.
  • ab55288 at 10 ug/ml staining HSPA1B in human Hella cells by Immunocytochemistry/ Immunofluorescence.

References for Anti-Hsp70 antibody (ab55288)

ab55288 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

We have not determined the cross reactivity of ab55288 with HSC70 protein. The immunogen of ab55288 shows 67% intermittent similarity in amino acids with HSC70, which is significantly below than percentage of homol...

Read More

Thank you for your reply. In the last email I sent, I asked if you would like me to send the replacement antibody and have it arrive on the 27th December or if you would prefer me to hold the item and have it shipped after the 2 January (I asked as a l...

Read More

Thank you for contacting Abcam. I am sorry that the vial of ab55288 that you received was short by 19ul and also for any negative affect that the shortage may have on your experiments. I am going to send you a replacement vial of ab5528...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"