Anti-Hsp70 antibody [C92F3A-5] (ab47455)
Key features and details
- Mouse monoclonal [C92F3A-5] to Hsp70
- Suitable for: WB, Flow Cyt, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG1
Related conjugates and formulations
Overview
-
Product name
Anti-Hsp70 antibody [C92F3A-5]
See all Hsp70 primary antibodies -
Description
Mouse monoclonal [C92F3A-5] to Hsp70 -
Host species
Mouse -
Specificity
Detects a 70kDa protein corresponding to the molecular mass of Hsp70 of SDS PAGE immunoblots. There is no cross-reactivity to Hsc70 (Hsp73). -
Tested applications
Suitable for: WB, Flow Cyt, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow, Dog, Pig, Caenorhabditis elegans, Macaque monkey, Bos mutus grunniens, Saguinus oedipus, Onchocerca volvulus, Oncorhynchus tshawytscha -
Immunogen
Recombinant fragment corresponding to Human Hsp70 aa 436-503.
Sequence:YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI DANGILNVTATDKSTGKANKITI
Database link: P08107 -
Epitope
The mapped epitope is in the region of amino acid residues 436-503. -
Positive control
- WB: HeLa, A431, A549, HCT116, HEK293, HepG2, HL-60, HUVEC, Jurkat, MCF7, PC3, T98G cell lysates; Rat Brain tumour lysate; Rat bone lysate. IHC-P: Mouse colon cancer tissue; human colon cancer tissue. Flow cyt: Heat Shocked CD3+ CD8+ T cells
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.1% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
C92F3A-5 -
Isotype
IgG1 -
Research areas
Associated products
-
Alternative Versions
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab47455 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (3) |
1/1000. Predicted molecular weight: 70 kDa.
|
Flow Cyt |
1/1000.
ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
|
IHC-P |
1/10000.
|
Notes |
---|
WB
1/1000. Predicted molecular weight: 70 kDa. |
Flow Cyt
1/1000. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
IHC-P
1/10000. |
Target
-
Relevance
Function: In cooperation with other chaperones, the Hsp70 family stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. In case of rotavirus A infection, serves as a post-attachment receptor for the virus to facilitate entry into the cell. Tissue specificity: HSPA1B is testis-specific. -
Cellular localization
Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs. -
Database links
- Entrez Gene: 281825 Cow
- Entrez Gene: 403612 Dog
- Entrez Gene: 15511 Human
- Entrez Gene: 3303 Human
- Entrez Gene: 193740 Mouse
- Entrez Gene: 3304 Mouse
- Entrez Gene: 396906 Pig
- Entrez Gene: 24472 Rat
see all -
Alternative names
- DnaK type molecular chaperone HSP70 1 antibody
- Epididymis secretory protein Li 103 antibody
- FLJ54303 antibody
see all
Images
-
All lanes : Anti-Hsp70 antibody [C92F3A-5] (ab47455) at 1 µg/ml
Lane 1 : Cell lysate prepared from human A431 cell line
Lane 2 : Cell lysate prepared from human A549 cell line
Lane 3 : Cell lysate prepared from human HCT116 cells line
Lane 4 : Cell lysate prepared from human Hela cell line
Lane 5 : Cell lysate prepared from human HEK293 cell line
Lane 6 : Cell lysate prepared from human HepG2 cell line
Lane 7 : Cell lysate prepared from human HL-60 cell line
Lane 8 : Cell lysate prepared from human HUVEC cell line
Lane 9 : Cell lysate prepared from human Jurkat cell line
Lane 10 : Cell lysate prepared from human MCF7 cell line
Lane 11 : Cell lysate prepared from human PC3 cell line
Lane 12 : Cell lysate prepared from human T98G cell line
Lane 13 : Rat brain tissue lysates
Predicted band size: 70 kDaAll are cancer cell lines.
-
Formalin-fixed, paraffin-embedded human colon carcinoma tissue stained for Hsp70 using ab47455 at 1/1000 dilution in immunohistochemical analysis. Counter stained with hematoxylin.
-
All lanes : Anti-Hsp70 antibody [C92F3A-5] (ab47455) at 1/500 dilution
All lanes : Rat bone (tibia) whole cell lysate
Lysates/proteins at 50 µg per lane.
Predicted band size: 70 kDa
-
ab47455 staining Hsp70 in mouse colon cancer tissue section by Immunohistochemistry (Bouin's fixed paraffin embedded tissue sections). The primary antibody was diluted at 1/100,000. A Fluorophore conjugated goat anti mouse was used as secondary. An antibody amplifier™ system was used for staining.
-
FACS analysis using ab47455 staining heat shock treated CD3 + CD8 + T cells.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (40)
ab47455 has been referenced in 40 publications.
- Roboti P et al. Mitochondrial antiviral-signalling protein is a client of the BAG6 protein quality control complex. J Cell Sci 135:N/A (2022). PubMed: 35543156
- Andersson R et al. Differential role of cytosolic Hsp70s in longevity assurance and protein quality control. PLoS Genet 17:e1008951 (2021). PubMed: 33428620
- Andersson S et al. Genome-wide imaging screen uncovers molecular determinants of arsenite-induced protein aggregation and toxicity. J Cell Sci 134:N/A (2021). PubMed: 34085697
- McMahon S et al. DNAJB chaperones suppress destabilised protein aggregation via a region distinct from that used to inhibit amyloidogenesis. J Cell Sci 134:N/A (2021). PubMed: 33674449
- Shi H et al. Regulating glycolysis, the TLR4 signal pathway and expression of RBM3 in mouse liver in response to acute cold exposure. Stress 22:366-376 (2019). PubMed: 30821572