Overview

  • Product name
    Anti-Hsp70 antibody [C92F3A-5]
    See all Hsp70 primary antibodies
  • Description
    Mouse monoclonal [C92F3A-5] to Hsp70
  • Host species
    Mouse
  • Specificity
    Detects a 70kDa protein corresponding to the molecular mass of Hsp70 of SDS PAGE immunoblots. There is no cross-reactivity to Hsc70 (Hsp73).
  • Tested applications
    Suitable for: Electron Microscopy, WB, IP, ELISA, ICC/IF, Flow Cyt, IHC-Fr, IHC-Pmore details
  • Species reactivity
    Reacts with: Rat, Human
    Predicted to work with: Mouse, Cow, Dog, Pig, Caenorhabditis elegans, Macaque monkey, Bos mutus grunniens, Saguinus oedipus, Onchocerca volvulus, Oncorhynchus tshawytscha
  • Immunogen

    Recombinant fragment corresponding to Human Hsp70 aa 436-503.
    Sequence:

    YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI DANGILNVTATDKSTGKANKITI


    Database link: P08107

  • Epitope
    The mapped epitope is in the region of amino acid residues 436-503.
  • Positive control
    • WB: HeLa, A431, A549, HCT116, HEK293, HepG2, HL-60, HUVEC, Jurkat, MCF7, PC3, T98G cell lysates; Rat Brain tumour lysate; Rat bone lysate. IHC-P: Mouse colon cancer tissue; human colon cancer tissue. Flow cyt: HeLa cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Preservative: 0.09% Sodium azide
    Constituents: 50% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Protein G purified
  • Clonality
    Monoclonal
  • Clone number
    C92F3A-5
  • Isotype
    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab47455 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Electron Microscopy Use at an assay dependent concentration.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 70 kDa.
IP Use at an assay dependent concentration.
ELISA Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.
Flow Cyt Use 1µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

IHC-Fr Use at an assay dependent concentration.
IHC-P Use at an assay dependent concentration.

Target

Images

  • All lanes : Anti-Hsp70 antibody [C92F3A-5] (ab47455) at 1 µg/ml

    Lane 1 : Cell lysate prepared from human A431 cell line
    Lane 2 : Cell lysate prepared from human A549 cell line
    Lane 3 : Cell lysate prepared from human HCT116 cells line
    Lane 4 : Cell lysate prepared from human Hela cell line
    Lane 5 : Cell lysate prepared from human HEK293 cell line
    Lane 6 : Cell lysate prepared from human HepG2 cell line
    Lane 7 : Cell lysate prepared from human HL-60 cell line
    Lane 8 : Cell lysate prepared from human HUVEC cell line
    Lane 9 : Cell lysate prepared from human Jurkat cell line
    Lane 10 : Cell lysate prepared from human MCF7 cell line
    Lane 11 : Cell lysate prepared from human PC3 cell line
    Lane 12 : Cell lysate prepared from human T98G cell line
    Lane 13 : Rat brain tissue lysates

    Predicted band size: 70 kDa



    All are cancer cell lines.

  • Western blot of Hela cell heat shock lysate, using HRP conjugated goat anti-mouse secondary antibody for detection. (1µg/mL ab47455 was used to detect in 10µg of heat shocked HeLa cell lysate)

  • Formalin-fixed, paraffin-embedded human colon carcinoma tissue stained for Hsp70 using ab47455 at 1/1000 dilution in immunohistochemical analysis. Counter stained with hematoxylin.

  • All lanes : Anti-Hsp70 antibody [C92F3A-5] (ab47455) at 1/500 dilution

    All lanes : Rat bone (tibia) whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Predicted band size: 70 kDa

    See Abreview

  • ab47455 staining Hsp70 in mouse colon cancer tissue section by Immunohistochemistry (Bouin's fixed paraffin embedded tissue sections). The primary antibody was diluted at 1/100,000. A Fluorophore conjugated goat anti mouse was used as secondary.  An antibody amplifier™ system was used for staining.

  • Overlay histogram showing HeLa cells stained with ab47455 (red line). The cells were fixed with methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab47455, 1µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1:500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a significantly decreased signal in HeLa cells fixed with 4% paraformaldehyde (10 min)/permeabilized in 0.1% PBS-Tween used under the same conditions.

References

This product has been referenced in:
  • Aprile FA  et al. The molecular chaperones DNAJB6 and Hsp70 cooperate to suppress a-synuclein aggregation. Sci Rep 7:9039 (2017). Read more (PubMed: 28831037) »
  • Lian S  et al. Impact of prenatal cold stress on placental physiology, inflammatory response, and apoptosis in rats. Oncotarget 8:115304-115314 (2017). Read more (PubMed: 29383161) »

See all 19 Publications for this product

Customer reviews and Q&As

Application
Western blot
Sample
Rat Tissue lysate - whole (Bone tissue (Tibia))
Gel Running Conditions
Reduced Denaturing (12,5%)
Loading amount
50 µg
Specification
Bone tissue (Tibia)
Blocking step
Milk as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C
Username

Abcam user community

Verified customer

Submitted Aug 25 2015

In normal cells there is still some low expression of HSP70, which is upregulated by heat or injury. I hope this information is helpfu.

Thank you for contacting us.

Yes, this product has been tested sucessfully in rabbit for Western Blotting. Our results show a clean band.

The antibody should specifically detect HSP70 and not HSP73.

Regarding local injury, I ...

Read More

Vielen Dank für Ihre Antwort.

Die Frau Hoffmann ist außer Haus und ich hoffe es ist Ihnen Recht, dass ich mich um Ihren Fall kümmere.

Unser AbTrial ist nur ein Angebot, welches Sie nicht in Anspruch nehmen müssen....

Read More

Vielen Dank für Ihre Email.

Leider bieten wir generell keine Probegrößen zu Testzwecken an. Es ist logistisch bei über 95000 Produkten nicht möglich kleinere Größen anzubieten.

Unserem Wissen na...

Read More

Thank you very much for your call yesterday and for your patience while I've been in touch with the lab about ab47455.

The antibody was used at a 1:100,000 dilution using a novel antibody amplification system, so these results are not typical...

Read More

Thank you for getting back to me.

I agree that it does seem more sensible to try a different antibody as the vial you initially received was showing activity with the human protein. The two alternatives you have suggested, ab2787 or ab5439, h...

Read More

Thank you for contacting us.



I have asked our accounting department to issue a credit note for you, which can be redeemed against the invoice of a future order by passing it on to your purchasing department. To avoid confusion, pl...

Read More

Thank you for your reply.

Your credit note IDsare *******.

I am sorry that this antibody did not perform as stated on the datasheet. If payment has already been made on the original order and you wish to receive a refund, please a...

Read More

I am very pleased to hear you would like to accept our offer and test ab47544 in Bluegill tissues. This code will give you: 1 free PRIMARY ANTIBODY OR VALUE OFF OF ORDER before the expiration date. To redeem this offer, please submit an Abreview for Bl...

Read More

1-10 of 17 Abreviews or Q&A

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up