Overview

  • Product nameAnti-HSPA4L antibody
    See all HSPA4L primary antibodies
  • Description
    Rabbit polyclonal to HSPA4L
  • Tested applicationsSuitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide, corresponding to a region within C terminal amino acids 720-769 (

    RNKDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVS

    ) of human HSPA4L (NP_055093).

  • Positive control
    • Fetal brain lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • Purification notesPurified by peptide affinity chromatography method.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81221 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:312500

WB Use a concentration of 1 µg/ml. Predicted molecular weight: 94 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceThe HSPA4L gene, also known as Apg1 or Osp94, belongs to the HSP110 heat shock gene family, which includes three genes encoding highly conserved proteins. HSPA4L is expressed ubiquitously and predominantly in the testis.
  • Cellular localizationCytoplasm; Nucleus. Note= May translocate to the nucleus after heat shock
  • Database links
  • Alternative names
    • 94kDa antibody
    • AI461691 antibody
    • APG 1 antibody
    • Heat shock 70kDa protein 4 like antibody
    • MGC117843 antibody
    • MGC187594 antibody
    • Osmotic stress protein 94 antibody
    • Osp94 antibody
    • OTTMUSP00000027739 antibody
    see all

Anti-HSPA4L antibody images

  • Anti-HSPA4L antibody (ab81221) at 1 µg/ml (in 5% skim milk / PBS buffer) + fetal brain lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 94 kDa
    Observed band size : 90 kDa (why is the actual band size different from the predicted?)

References for Anti-HSPA4L antibody (ab81221)

ab81221 has not yet been referenced specifically in any publications.

Product Wall

Abcam guarantees this product to work in the species/application used in this Abreview.
Application Western blot
Sample Human Cell lysate - whole cell (Breast cell line)
Loading amount 200000 cells
Specification Breast cell line
Gel Running Conditions Reduced Denaturing (12.5 % gel)
Blocking step Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3%
Username

Abcam user community

Verified customer

Submitted Feb 09 2012

Abcam has not validated the combination of species/application used in this Abreview.
Application Immunoprecipitation
Sample Human Cell lysate - whole cell (breast cell line)
Total protein in input 3e+006 cells
Specification breast cell line
Immuno-precipitation step Protein A
Username

Abcam user community

Verified customer

Submitted Jan 27 2012

Abcam has not validated the combination of species/application used in this Abreview.
Application Immunocytochemistry
Sample Human Cultured Cells (Breast cell line)
Specification Breast cell line
Fixative Methanol
Blocking step BSA as blocking agent for 30 minute(s) · Concentration: 10%
Username

Abcam user community

Verified customer

Submitted Jan 27 2012

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"