Overview

  • Product nameAnti-htrA4 antibody
    See all htrA4 primary antibodies
  • Description
    Rabbit polyclonal to htrA4
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 396-445 (

    LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTD

    ) of Human htrA4 (NP_710159).

  • Positive control
    • Human Fetal Brain Lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab84894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 51 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-htrA4 antibody images

  • Anti-htrA4 antibody (ab84894) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human Fetal Brain lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 51 kDa
    Observed band size : 51 kDa
    Additional bands at : 33 kDa,35 kDa. We are unsure as to the identity of these extra bands.

References for Anti-htrA4 antibody (ab84894)

ab84894 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"