Overview

  • Product name
  • Description
    Mouse monoclonal to HuD
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HuD aa 312-381.
    Sequence:

    VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGY RLGDRVLQVSFKTNKAHKS

  • General notes

    Abcam is committed to meeting high standards of ethical manufacturing and has decided to discontinue this product by July 2018 as it has been generated by the ascites method. We are sorry for any inconvenience this may cause. 

Properties

Applications

Our Abpromise guarantee covers the use of ab54988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 42 kDa.
IHC-P Use a concentration of 1.2 µg/ml.

Target

  • Function
    May play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3'-UTR (By similarity). Binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.
  • Tissue specificity
    Brain.
  • Sequence similarities
    Belongs to the RRM elav family.
    Contains 3 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications
    Methylation at Arg-243 by CARM1 weakens protective binding to the 3'-UTR of CDKN1A mRNA and down-regulates CDKN1A protein expression, thereby maintaining cells in a proliferative state. Methylation is inhibited by NGF, which facilitates neurite outgrowth.
  • Information by UniProt
  • Database links
  • Alternative names
    • ELAV (embryonic lethal abnormal vision Drosophila) like 4 antibody
    • ELAV L4 antibody
    • ELAV like 4 antibody
    • ELAV like protein 4 antibody
    • ELAV-like protein 4 antibody
    • ELAV4_HUMAN antibody
    • Elavl4 antibody
    • Embryonic lethal abnormal vision Drosophila homolog of like 4 antibody
    • Hu antigen D antibody
    • Hu-antigen D antibody
    • HuD antibody
    • Paraneoplastic encephalomyelitis antigen HuD antibody
    • PNEM antibody
    see all

Images



  • Predicted band size : 42 kDa
    ELAVL4 antibody (ab54988) at 1ug/lane + IMR-32 cell lysate at 25ug/lane.
  • ab54988 at 1.2 ug/ml staining HuD in human cerebral cortex tissue section by Immunhistochemistry (Formalin /PFA fixed paraffin-embedded sections).

References

ab54988 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for your e-mail. With regard to your enquiry, we don't have cross-reactivity data for ELAVL4 monoclonal antibody (ab54988). The immunogen used to raise this antibody is ELAVL4 (312 a.a. ~ 381 a.a) partial recombinant protein with GST ta...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up