Overview

  • Product name
  • Description
    Mouse monoclonal to HuD
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HuD aa 312-381.
    Sequence:

    VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGY RLGDRVLQVSFKTNKAHKS

Properties

Applications

Our Abpromise guarantee covers the use of ab54988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 42 kDa.
IHC-P Use a concentration of 1.2 µg/ml.

Target

  • Function
    May play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3'-UTR (By similarity). Binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.
  • Tissue specificity
    Brain.
  • Sequence similarities
    Belongs to the RRM elav family.
    Contains 3 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications
    Methylation at Arg-243 by CARM1 weakens protective binding to the 3'-UTR of CDKN1A mRNA and down-regulates CDKN1A protein expression, thereby maintaining cells in a proliferative state. Methylation is inhibited by NGF, which facilitates neurite outgrowth.
  • Information by UniProt
  • Database links
  • Alternative names
    • ELAV (embryonic lethal abnormal vision Drosophila) like 4 antibody
    • ELAV L4 antibody
    • ELAV like 4 antibody
    • ELAV like protein 4 antibody
    • ELAV-like protein 4 antibody
    • ELAV4_HUMAN antibody
    • Elavl4 antibody
    • Embryonic lethal abnormal vision Drosophila homolog of like 4 antibody
    • Hu antigen D antibody
    • Hu-antigen D antibody
    • HuD antibody
    • Paraneoplastic encephalomyelitis antigen HuD antibody
    • PNEM antibody
    see all

Anti-HuD antibody images



  • Predicted band size : 42 kDa
    ELAVL4 antibody (ab54988) at 1ug/lane + IMR-32 cell lysate at 25ug/lane.
  • ab54988 at 1.2 ug/ml staining HuD in human cerebral cortex tissue section by Immunhistochemistry (Formalin /PFA fixed paraffin-embedded sections).

References for Anti-HuD antibody (ab54988)

ab54988 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your e-mail. With regard to your enquiry, we don't have cross-reactivity data for ELAVL4 monoclonal antibody (ab54988). The immunogen used to raise this antibody is ELAVL4 (312 a.a. ~ 381 a.a) partial recombinant protein with GST ta...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up