Human 5HT5A receptor full length protein (ab114804)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP47898
    • SpeciesHuman
    • SequenceMDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFL VAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVH ELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYT LRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSY AVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKD SAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFK NFFSRQH
    • Molecular weight65 kDa including tags
    • Amino acids1 to 357

Specifications

Our Abpromise guarantee covers the use of ab114804 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 µg/ul.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • HTR5A
    • 5 HT 5A
    • 5 hydroxytryptamine 5A receptor
    • 5-HT-5
    • 5-HT-5A
    • 5-HT5A
    • 5-hydroxytryptamine receptor 5A
    • 5HT5A
    • 5HT5A_HUMAN
    • HTR5A
    • Serotonin receptor 5A
    see all
  • FunctionThis is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family.
  • Cellular localizationCell membrane.
  • Target information above from: UniProt accession P47898 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human 5HT5A receptor full length protein images

  • ab114804 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Human 5HT5A receptor full length protein (ab114804)

ab114804 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114804.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"