Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ96II5
    • SpeciesHuman
    • SequenceMEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALK VRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHN FVRKTFFSLAFCDFCLKFLFHGFRCQTCGYKFHQHCSSKVPTVCVDMSTN RQQPSRFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHF PFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSR GGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYR DSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVSQPTAEQ AQAFKNEMQVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVA DTRFDMVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGD FGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGV VLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPKAMRRLLS DCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPAC LLSAARLVP
    • Molecular weight93 kDa including tags
    • Amino acids1 to 609

Specifications

Our Abpromise guarantee covers the use of ab132213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • A raf 1
    • A Raf proto oncogene serine/threonine protein kinase
    • Araf
    • ARAF 1
    • ARaf proto oncogene serine/threonine protein kinase
    • ARAF_HUMAN
    • ARAF1
    • Oncogene Araf1
    • Oncogene PKS2
    • PKS
    • PKS 2
    • PKS2
    • Proto oncogene Pks
    • Proto-oncogene A-Raf
    • Proto-oncogene A-Raf-1
    • Proto-oncogene Pks
    • RAFA 1
    • RAFA1
    • Ras binding protein DA Raf
    • Serine/threonine-protein kinase A-Raf
    • v raf murine sarcoma 3611 viral oncogene homolog
    • v raf murine sarcoma 3611 viral oncogene homolog 1
    • v raf oncogene homolog 1 (murine sarcoma 3611 virus)
    see all
  • FunctionInvolved in the transduction of mitogenic signals from the cell membrane to the nucleus.
  • Tissue specificityPredominantly in urogenital tissues.
  • Sequence similaritiesBelongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. RAF subfamily.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 protein kinase domain.
    Contains 1 RBD (Ras-binding) domain.
  • Information by UniProt

Human A RAF full length protein images

  • 12.5% SDS-PAGE analysis of ab132213 stained with Coomassie Blue.

References for Human A RAF full length protein (ab132213)

ab132213 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab132213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"