Overview

  • Product nameHuman A2LD1 full length protein

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionQ9BVM4
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMALVFVYGTLKRGQPNHRVLRDGAHGSAAF RARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDD FESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQ LPHHDSYDSEGPHGLRYNPRENR
    • Molecular weight19 kDa including tags
    • Amino acids1 to 153
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104748 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % by SDS-PAGE.
    ab104748 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0

General info

  • Alternative names
    • A2ld1
    • A2LD1_HUMAN
    • AIG2-like domain-containing protein 1
    • Gamma-glutamylamine cyclotransferase
    • Gamma-glutamylaminecyclotransferase
    • GGACT
    • GGACT_HUMAN
    see all
  • FunctionContributes to degradation of proteins cross-linked by transglutaminases. Degrades the cross-link between a lysine and a glutamic acid residue from two proteins that have been cross-linked by transglutaminases. Catalyzes the formation of 5-oxoproline from L-gamma-glutamyl-L-epsilon-lysine. Inactive with L-gamma-glutamyl-alpha-amino acid substrates such as L-gamma-glutamyl-L-alpha-cysteine and L-gamma-glutamyl-L-alpha-alanine.
  • Sequence similaritiesBelongs to the gamma-glutamylcyclotransferase family.
  • Information by UniProt

Human A2LD1 full length protein images

  • 15% SDS-PAGE (3µg).

References for Human A2LD1 full length protein (ab104748)

ab104748 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104748.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"