Overview

  • Product nameHuman AASDHPPT protein fragment
  • DescriptionHuman AASDHPPT protein fragment

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionQ9NRN7
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMEGVRWAFSCGTWLPSRAEWLLAVRSIQPE EKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPV LAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPE FFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGF ELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAV ALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWD CFCFTEEIPIRNGTKS
    • Molecular weight36 kDa including tags
    • Amino acids14 to 309
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99433 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % by SDS-PAGE.
    ab99433 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General info

  • Alternative names
    • 4' phosphopantetheinyl transferase
    • 4'-phosphopantetheinyl transferase
    • AASD PPT
    • AASD-PPT
    • AASDHPPT
    • ADPPT_HUMAN
    • Alpha aminoadipic semialdehyde dehydrogenase phosphopantetheinyl transferase
    • Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase
    • CGI 80
    • HAH P
    • L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
    • LYS2
    • LYS5
    • LYS5 ortholog
    see all
  • FunctionCatalyzes the post-translational modification of target proteins by phosphopantetheine. Can transfer the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of a broad range of acceptors, such as the acyl carrier domain of FASN.
  • Tissue specificityDetected in heart, skeletal muscle, placenta, testis, brain, pancreas, liver and kidney.
  • Sequence similaritiesBelongs to the P-Pant transferase superfamily. AcpS family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Human AASDHPPT protein fragment images

  • 15% SDS-PAGE showing ab99433 at approximately 36.4kDa (3µg).

References for Human AASDHPPT protein fragment (ab99433)

ab99433 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99433.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"