Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO75027-2
    • SpeciesHuman
    • SequencePQWRPHQLGALGTARAYQQIPESLKSITWQRLGKGNSGQFLDAAKALQVW PLIEKRTCWHGHAGGGLHTDPKEGLKDVDTRKIIKAMLSYVWPKDRPDLR ARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMSGNMLNLSDAPNTVAT MATAVLIGYGVSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLD LGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIMFEVMLVSGVLYY KCGAQFALVTLGTLGTYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSL LNYETVKYFNNERYEAQRYDGFLKTYETASLKSTSTLAMLNFGQSAIFSV GLTAIMVLASQGIVAGTLTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQA LIDMNTLFTLLKVDTQIKDKVMASPLQITPQTATVAFDNVHFEYIEGQKV LSGISFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNIQ DVSLESLRRAVGVVPQDAVLFHNTIYYNLLYGNISASPEEVYAVAKLAGL HDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATS SLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAER GTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQ EEIVNSVKGCGNCSC
    • Molecular weight105 kDa including tags
    • Amino acids39 to 753

Specifications

Our Abpromise guarantee covers the use of ab114672 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • ABC transporter 7 protein
    • ABC7
    • Abcb7
    • ABCB7_HUMAN
    • ASAT
    • Atm1p
    • ATP binding cassette 7
    • ATP binding cassette sub family B (MDR/TAP) member 7
    • ATP binding cassette sub family B member 7
    • ATP binding cassette sub family B member 7 mitochondrial
    • ATP binding cassette transporter 7
    • ATP-binding cassette sub-family B member 7
    • ATP-binding cassette transporter 7
    • EST140535
    • MDR7
    • mitochondrial
    • Multidrug resistance protein 7
    • P-glycoprotein 7
    • PGP7
    see all
  • FunctionCould be involved in the transport of heme from the mitochondria to the cytosol. Plays a central role in the maturation of cytosolic iron-sulfur (Fe/S) cluster-containing proteins.
  • Involvement in diseaseDefects in ABCB7 are the cause of X-linked sideroblastic anemia with ataxia (ASAT) [MIM:301310]. ASAT is a recessive disorder characterized by an infantile to early childhood onset of nonprogressive cerebellar ataxia and mild anemia with hypochromia and microcytosis.
  • Sequence similaritiesBelongs to the ABC transporter superfamily. ABCB family. Heavy Metal importer (TC 3.A.1.210) subfamily.
    Contains 1 ABC transmembrane type-1 domain.
    Contains 1 ABC transporter domain.
  • Cellular localizationMitochondrion inner membrane.
  • Target information above from: UniProt accession O75027 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human ABCB7 full length protein images

  • SDS-PAGE analysis of ab114672 on a 12.5% gel stained with Coomassie Blue.

References for Human ABCB7 full length protein (ab114672)

ab114672 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114672.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"