Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13686
    • SpeciesHuman
    • SequenceMGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAH AARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFI FIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEF LRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLS EQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQ SAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEG LPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATD QNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS
    • Molecular weight68 kDa including tags
    • Amino acids1 to 389

Specifications

Our Abpromise guarantee covers the use of ab132191 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • ABH
    • ABH1
    • alkB
    • AlkB, alkylation repair homolog 1 (E. coli)
    • ALKB1_HUMAN
    • ALKBH
    • ALKBH1
    • Alkylated DNA repair protein alkB homolog 1
    • Alkylation repair homolog 1
    • Alkylation repair, alkB homolog
    • Alpha-ketoglutarate-dependent dioxygenase ABH1
    • DNA lyase ABH1
    • DNA oxidative demethylase ALKBH1
    • hABH
    see all
  • FunctionDioxygenase that repairs alkylated single-stranded DNA and RNA containing 3-methylcytosine by oxidative demethylation. Requires molecular oxygen, alpha-ketoglutarate and iron. May have a role in placental trophoblast lineage differentiation (By similarity). Has DNA lyase activity and introduces double-stranded breaks at abasic sites. Cleaves both single-stranded DNA and double-stranded DNA at abasic sites, with the greatest activity towards double-stranded DNA with two abasic sites. DNA lyase activity does not require alpha-ketoglutarate and iron.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the alkB family.
    Contains 1 Fe2OG dioxygenase domain.
  • Cellular localizationMitochondrion. Nucleus. Mainly localizes in euchromatin, largely excluded from heterochromatin and nucleoli.
  • Information by UniProt

Human ABH1 full length protein images

  • 12.5% SDS-PAGE analysis of ab132191 stained with Coomassie Blue.

References for Human ABH1 full length protein (ab132191)

ab132191 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab132191.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"