Human ABH2 full length protein (ab105622)

Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionQ6NS38
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMDRFLVKGAQGGLLRKQEEQEPTGEEPAVL GGDKESTRKRPRREAPGNGGHSAGPSWRHIRAEGLDCSYTVLFGKAEADE IFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLS PKPWIPVLERIRDHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAP GSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPT NTHWYHSLPVRKKVLAPRVNLTFRKILLTKK
    • Molecular weight31 kDa including tags
    • Amino acids1 to 261
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % by SDS-PAGE.
    ab105622 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General info

  • Alternative names
    • 2OG Fe(II) oxy DC1
    • 9530023G02
    • ABH 2
    • ABH2
    • alkB alkylation repair homolog 2
    • ALKB2_HUMAN
    • ALKBH2
    • ALKBH2 alkB
    • Alkylated DNA repair protein alkB homolog
    • Alkylated DNA repair protein alkB homolog 2
    • Alkylation repair homolog 2
    • Alpha ketoglutarate dependent dioxygenase alkB homolog 2
    • Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2
    • AU016977
    • DNA oxidative demethylase ALKBH2
    • EC 1.14.11.
    • FLJ99103
    • hABH2
    • mABH2
    • MGC90512
    • Oxy DC1
    see all
  • FunctionDioxygenase that repairs alkylated DNA and RNA containing 1-methyladenine and 3-methylcytosine by oxidative demethylation. Can also repair alkylated DNA containing 1-ethenoadenine (in vitro). Has strong preference for double-stranded DNA. Has low efficiency with single-stranded substrates. Requires molecular oxygen, alpha-ketoglutarate and iron.
  • Tissue specificityDetected in colon, small intestine, ovary, testis, prostate, skeletal muscle, heart, liver and urinary bladder.
  • Sequence similaritiesBelongs to the alkB family.
    Contains 1 Fe2OG dioxygenase domain.
  • Cellular localizationNucleus. Detected in replication foci during S-phase.
  • Target information above from: UniProt accession Q6NS38 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human ABH2 full length protein images

  • 15% SDS-PAGE analysis of ab105622 (3µg)

References for Human ABH2 full length protein (ab105622)

ab105622 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your call today and letting us know about the trouble with ab105622.

As we discussed, I'd be happy to give you a 20% discount on another vial of ab105622 or alternatively you can participate in our testing discount program. In t...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"