Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9BV23
    • SpeciesHuman
    • SequenceMDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQV RYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHL VCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMG GQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKI PLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEI VSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL LENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
    • Molecular weight65 kDa
    • Amino acids1 to 337

Specifications

Our Abpromise guarantee covers the use of ab132683 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • 0610041D24Rik
    • 2 arachidonoylglycerol hydrolase
    • AA673485
    • Abhydrolase domain containing 6
    • Abhydrolase domain containing protein 6
    • AV065425
    • Llipase protein
    • MGC94917
    see all
  • RelevanceABHD6 belongs to the alpha/beta hydrolase superfamily. It is highly expressed in mammalian brain and catalyzes the hydrolysis of the endocannabinoid 2-arachidonoyl glycerol (2-AG).
  • Cellular localizationMembrane; Single-pass type II membrane protein

Human ABHD6 full length protein images

  • 12.5% SDS-PAGE analysis of ab132683 stained with Coomassie Blue.

References for Human ABHD6 full length protein (ab132683)

ab132683 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab132683.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"