Human ABLIM1 full length protein (ab116851)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO14639
    • SpeciesHuman
    • SequenceMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRAKVDNEILDYKDLAAIPKV KAIYDIERPDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQDV RDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPDQGINIYRKPPI YKQHAALAAQSKSSEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAV VGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKES RERSSLLASRYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNS YGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRG RNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKL F
    • Molecular weight70 kDa including tags
    • Amino acids1 to 401

Specifications

Our Abpromise guarantee covers the use of ab116851 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • ABLIM
    • ABLIM 1
    • abLIM-1
    • ABLIM-L
    • ABLIM-M
    • ABLIM-S
    • ABLIM1
    • ABLM1_HUMAN
    • Actin binding double zinc finger protein
    • Actin binding LIM protein 1
    • Actin binding LIM protein family member 1
    • Actin-binding double zinc finger protein
    • Actin-binding LIM protein 1
    • Actin-binding LIM protein family member 1
    • DKFZp781D0148
    • FLJ14564
    • KIAA0059
    • LIM actin binding protein 1
    • LIMAB 1
    • LIMAB1
    • Limatin
    • MGC1224
    • MGC125264
    • OTTHUMP00000020530
    • OTTHUMP00000020531
    • OTTHUMP00000020532
    • OTTHUMP00000020533
    • OTTHUMP00000020534
    • OTTHUMP00000020535
    • OTTHUMP00000020536
    • OTTHUMP00000020537
    • RGD1565768
    • RP11-317F20.1
    see all
  • FunctionMay act as scaffold protein (By similarity). May play a role in the development of the retina. Has been suggested to play a role in axon guidance.
  • Tissue specificityDetected in liver, heart, skeletal muscle, brain and retina, where it is concentrated in the inner segment and in the outer plexiform layers.
  • Sequence similaritiesContains 1 HP (headpiece) domain.
    Contains 4 LIM zinc-binding domains.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationCytoplasm. Cytoplasm > cytoskeleton. Associated with the cytoskeleton.
  • Target information above from: UniProt accession O14639 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human ABLIM1 full length protein images

  • 12.5% SDS-PAGE showing ab116851 at approximately 70.18kDa, stained with Coomassie Blue.

References for Human ABLIM1 full length protein (ab116851)

ab116851 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116851.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"