Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ6JQN1-4
    • SpeciesHuman
    • SequenceMGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGENGPWMRFMRAEITA EGFLREFGRLCSEMLKTSVPVDSFFSLLTSERVAKQFPVMTEAITQIRAK GLQTAVLSNNFYLPNQKSFLPLDRKQFDVIVESCMEGICKPDPRIYKLCL EQLGLQPSESIFLDDLGTNLKEAARLGIHTIKVNDPETAVKELEALLGFT LRVGVPNTRPVKKTMEIPKDSLQKYLKDLLGIQTTGL
    • Molecular weight53 kDa including tags
    • Amino acids49 to 285

Specifications

Our Abpromise guarantee covers the use of ab132687 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • ACAD 10
    • ACAD-10
    • ACAD10
    • ACD10_HUMAN
    • Acyl CoA dehydrogenase family member 10
    • Acyl-CoA dehydrogenase family member 10
    • acyl-Coenzyme A dehydrogenase family member 10
    • MGC5601
    see all
  • FunctionMay function as oxidoreductase.
  • Tissue specificityWidely expressed with higher expression in liver, kidney, pancreas and spleen.
  • Sequence similaritiesBelongs to the acyl-CoA dehydrogenase family.
  • Information by UniProt

Human ACAD10 protein fragment images

  • 12.5% SDS-PAGE analysis of ab132687 stained with Coomassie Blue.

References for Human ACAD10 protein fragment (ab132687)

ab132687 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab132687.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"