Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionP28330
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGGEERLETPSAKKLTDIGIRRIFSPEHDI FRKSVRKFFQEEVIPHHSEWEKAGEVSREVWEKAGKQGLLGVNIAEHLGG IGGDLYSAAIVWEEQAYSNCSGPGFSIHSGIVMSYITNHGSEEQIKHFIP QMTAGKCIGAIAMTEPGAGSDLQGIKTNAKKDGSDWILNGSKVFISNGSL SDVVIVVAVTNHEAPSPAHGISLFLVENGMKGFIKGRKLHKMGLKAQDTA ELFFEDIRLPASALLGEENKGFYYIMKELPQERLLIADVAISASEFMFEE TRNYVKQRKAFGKTVAHLQTVQHKLAELKTHICVTRAFVDNCLQLHEAKR LDSATACMAKYWASELQNSVAYDCVQLHGGWGYMWEYPIAKAYVDARVQP IYGGTNEIMKELIAREIVFDK
    • Molecular weight47 kDa including tags
    • Amino acids31 to 430
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113579 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % by SDS-PAGE.
    > 85 % by SDS - PAGE. ab113579 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride

General info

  • Alternative names
    • ACAD4
    • ACADL
    • ACADL_HUMAN
    • Acyl Coenzyme A dehydrogenase long chain
    • Acyl-CoA dehydrogenase long chain
    • FLJ94052
    • LCAD
    • Long chain acyl CoA dehydrogenase
    • Long-chain specific acyl-CoA dehydrogenase
    • Long-chain specific acyl-CoA dehydrogenase, mitochondrial
    • mitochondrial
    see all
  • PathwayLipid metabolism; mitochondrial fatty acid beta-oxidation.
  • Involvement in diseaseDefects in ACADL are a cause of acyl-CoA dehydrogenase very long-chain deficiency (ACADVLD) [MIM:201475]. An inborn error of mitochondrial fatty acid beta-oxidation which leads to impaired long-chain fatty acid beta-oxidation. It is clinically heterogeneous, with three major phenotypes: a severe childhood form characterized by early onset, high mortality and high incidence of cardiomyopathy; a milder childhood form with later onset, characterized by hypoketotic hypoglycemia, low mortality and rare cardiomyopathy; an adult form, with isolated skeletal muscle involvement, rhabdomyolysis and myoglobinuria, usually triggered by exercise or fasting.
  • Sequence similaritiesBelongs to the acyl-CoA dehydrogenase family.
  • Cellular localizationMitochondrion matrix.
  • Target information above from: UniProt accession P28330 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human ACADL full length protein images

  • 15% SDS-PAGE showing ab113579 (3µg).

References for Human ACADL full length protein (ab113579)

ab113579 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113579.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"