Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP78348
    • SpeciesHuman
    • SequenceMELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCF LGSLAVLLCVCTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRF SQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPK PFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSG RDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIH SQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLD FFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPAL DFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQY IGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILTV LELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESL RGHPAGMTYAANILPHHPARGTFEDFTC
    • Molecular weight84 kDa including tags
    • Amino acids1 to 528

Specifications

Our Abpromise guarantee covers the use of ab114681 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General info

  • Alternative names
    • ACCN2
    • ACCN2_HUMAN
    • Acid sensing ion channel
    • Acid sensing ion channel 1
    • Acid sensing ion channel 1a protein
    • Acid-sensing ion channel 1
    • AI843610
    • Amiloride sensitive cation channel 2 neuronal
    • Amiloride-sensitive cation channel 2
    • ASIC
    • ASIC1
    • ASIC1A
    • B530003N02Rik
    • BNaC2
    • Brain sodium channel 2
    • Cation channel amiloride sensitive neuronal 2
    • hBNaC2
    • neuronal
    see all
  • FunctionCation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Ca(2+), Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Mediates glutamate-independent Ca(2+) entry into neurons upon acidosis. This Ca(2+) overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties. Functions as a postsynaptic proton receptor that influences intracellular Ca(2+) concentration and calmodulin-dependent protein kinase II phosphorylation and thereby the density of dendritic spines. Modulates activity in the circuits underlying innate fear.
  • Tissue specificityExpressed in most or all neurons.
  • Sequence similaritiesBelongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. ACCN2 subfamily.
  • Post-translational
    modifications
    Phosphorylation by PKA regulates interaction with PRKCABP and subcellular location. Phosphorylation by PKC may regulate the channel.
  • Cellular localizationCell membrane. Localizes in synaptosomes at dendritic synapses of neurons. Colocalizes with DLG4.
  • Target information above from: UniProt accession P78348 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human ACCN2 full length protein images

  • ab114681 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Human ACCN2 full length protein (ab114681)

ab114681 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114681.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"